Recombinant Human CHRNA6, His-tagged
Cat.No. : | CHRNA6-68H |
Product Overview : | Recombinant Human Neuronal Acetylcholine Receptor Subunit α-6/CHRNA6 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (His328-Arg465) of Human CHRNA6 fused with a polyhistidine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
ProteinLength : | 328-465 a.a. |
AA Sequence : | EPSPGTLPRKAGVFSDLSNQELKAVHSFLWSKKELRLQPSSTTTMAKNTVFLIEMLLPKKYHVLR FLDKGERHPVREARAVIFFGDQEHPNVTEFAVGPLPGPCYMRALSPRPGYQSSWASRPISTAEYA LLYHTLQEATKPLHQFFLNTTGFSFQDCHDRCLAFTDVAPRGVASGQRRSWLIIQRYVEGYFLHP TGLELLVDHGSTDAGHWAVEQVWYNGKFYGSPEELARKYADGEVDVVVLEDPLPGGKGHDSTEEP PLFSSHKPRGDFPSPIHVSGPRLVQPHGPRFRLEGNAVLYGGWSFAFRLRSSSGLQVLNVHFGGE RIAYEVSVQEAVALYGGHTPAGMQTKYLDVGWGLGSVTHELAPGIDCPETATFLDTFHYYDADDP VHYPRALCLFEMPTGVPLRRHFNSNFKGGFNFYAGLKGQVLVLRTTSTVYNYDYIWDFIFYPNGV MEAKMHATGYVHATFYTPEGLRHGTRLHTHLIGNIHTHLVHYRVDLDVAGTKNSFQTLQMKLENI TNPWSPRHRVVQPTLEQTQYSWERQAAFRFKRKLPKYLLFTSPQENPWGHKRSYRLQIHSMADQV LPPGWQEEQAITWARYPLAVTKYRESELCSSSIYHQNDPWDPPVVFEQFLHNNENIENEDLVAWV TVGFLHIPHSEDIPNTATPGNSVGFLLRPFNFFPEDPSLASRDTVIVWPRDNGPNYVQRWIPEDR DCSMPPPFSYNGTYRPVVDHHHHHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Gene Name | CHRNA6 cholinergic receptor, nicotinic, alpha 6 (neuronal) [ Homo sapiens ] |
Official Symbol | CHRNA6 |
Synonyms | CHRNA6; cholinergic receptor, nicotinic, alpha 6 (neuronal); cholinergic receptor, nicotinic, alpha polypeptide 6; neuronal acetylcholine receptor subunit alpha-6; acetylcholine receptor; nicotinic; alpha 6 (neuronal); acetylcholine receptor, nicotinic, alpha 6 (neuronal); CHNRA6; |
Gene ID | 8973 |
mRNA Refseq | NM_001199279 |
Protein Refseq | NP_001186208 |
MIM | 606888 |
UniProt ID | Q15825 |
Chromosome Location | 8p22 |
Pathway | Acetylcholine Binding And Downstream Events, organism-specific biosystem; Activation of Nicotinic Acetylcholine Receptors, organism-specific biosystem; Cholinergic synapse, organism-specific biosystem; Highly calcium permeable nicotinic acetylcholine receptors, organism-specific biosystem; Highly calcium permeable postsynaptic nicotinic acetylcholine receptors, organism-specific biosystem; Neuroactive ligand-receptor interaction, organism-specific biosystem; Neuroactive ligand-receptor interaction, conserved biosystem; |
Function | acetylcholine receptor activity; acetylcholine-activated cation-selective channel activity; extracellular ligand-gated ion channel activity; ion channel activity; receptor activity; |
◆ Recombinant Proteins | ||
Ifi204-4632M | Recombinant Mouse Ifi204 protein, His-tagged | +Inquiry |
SAA4-6235H | Recombinant Human SAA4 Protein (Glu19-Thr130), C-His tagged | +Inquiry |
RFL4888EF | Recombinant Full Length Escherichia Coli Aquaporin Z (Aqpz) (Active) Protein, His-Tagged | +Inquiry |
LRRC19-9254M | Recombinant Mouse LRRC19 Protein | +Inquiry |
MYC-3317H | Recombinant Human MYC protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1768D | Active Native Datura Stramonium Lectin Protein | +Inquiry |
Clostripain-01C | Native Clostridium histolyticum Clostripain | +Inquiry |
PLAU-8456H | Active Native Human PLAU | +Inquiry |
KLK4-238H | Native Human Kallikrein | +Inquiry |
Immunoglobulin G-038S | Native Sheep Immunoglobulin G Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
LRPAP1-2574HCL | Recombinant Human LRPAP1 cell lysate | +Inquiry |
Lung-308H | Human Lung Cytoplasmic Lysate | +Inquiry |
FOPNL-8248HCL | Recombinant Human C16orf63 293 Cell Lysate | +Inquiry |
U-87-016HCL | Human U-87 MG Whole Cell Lysate | +Inquiry |
TBX3-1199HCL | Recombinant Human TBX3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All CHRNA6 Products
Required fields are marked with *
My Review for All CHRNA6 Products
Required fields are marked with *
0
Inquiry Basket