Recombinant Human CHMP5 Protein, GST-Tagged

• Cat.No.: CHMP5-1253H
• Product Overview: Human CHMP5 full-length ORF (NP_057494.2, 1 a.a. - 219 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: CHMP5 belongs to the chromatin-modifying protein/charged multivesicular body protein (CHMP) family. These proteins are components of ESCRT-III (endosomal sorting complex required for transport III), a complex involved in degradation of surface receptor proteins and formation of endocytic multivesicular bodies (MVBs). Some CHMPs have both nuclear and cytoplasmic/vesicular distributions, and one such CHMP, CHMP1A (MIM 164010), is required for both MVB formation and regulation of cell cycle progression (Tsang et al., 2006 [PubMed 16730941]).[supplied by OMIM, Mar 2008]
• Molecular Mass: 50.9 kDa
• AA Sequence: MNRLFGKAKPKAPPPSLTGCIGTVDSRAESIDKKISRLDAELVKYKDQIKKMREGPAKNMVKQKALRVLKQKRMYEQQRDNLAQQSFNMEQANYTIQSLKDTKTTVDAMKLGVKEMKKAYKQVKIDQIEDLQDQLEDMMEDANEIQEALSRSYGTPELDEDDLEAELDALGDELLADEDSSYLDEAASAPAIPEGVPTDTKNKDGVLVDEFGLPQIPAS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CHMP5 charged multivesicular body protein 5 [ Homo sapiens ]
• Official Symbol: CHMP5
• Synonyms: CHMP5; charged multivesicular body protein 5; C9orf83, chromatin modifying protein 5, chromosome 9 open reading frame 83, SNF7DC2; CGI 34; HSPC177; Vps60; hVps60; SNF7 domain containing 2; chromatin modifying protein 5; chromatin-modifying protein 5; SNF7 domain-containing protein 2; apoptosis-related protein PNAS-2; vacuolar protein sorting-associated protein 60; CGI-34; PNAS-2; C9orf83; SNF7DC2
• Gene ID: 51510
• mRNA Refseq: NM_001195536
• Protein Refseq: NP_001182465
• MIM: 610900
• UniProt ID: Q9NZZ3