Recombinant Human CHMP5, His-tagged

• Cat.No.: CHMP5-27751TH
• Product Overview: Recombinant full length protein, corresponding to amino acids 1-219 of Human CHMP5, with N terminal His tag; 219 amino acids, 34kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• ProteinLength: 1-219 a.a.
• Description: CHMP5 belongs to the chromatin-modifying protein/charged multivesicular body protein (CHMP) family. These proteins are components of ESCRT-III (endosomal sorting complex required for transport III), a complex involved in degradation of surface receptor proteins and formation of endocytic multivesicular bodies (MVBs). Some CHMPs have both nuclear and cytoplasmic/vesicular distributions, and one such CHMP, CHMP1A (MIM 164010), is required for both MVB formation and regulation of cell cycle progression (Tsang et al.
• Conjugation: HIS
• Form: Lyophilised:Reconstitution with 151 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MNRLFGKAKPKAPPPSLTDCIGTVDSRAESIDKKISRLDA ELVKYKDQIKKMREGPAKNMVKQKALRVLKQKRMYEQQ RDNLAQQSFNMEQANYTIQSLKDTKTTVDAMKLGVKEM KKAYKQVKIDQIEDLQDQLEDMMEDANEIQEALSRSYG TPELDEDDLEAELDALGDELLADEDSSYLDEAASAPAIPE GVPTDTKNKDGVLVDEFGLPQIPAS
• Full Length: Full L.

Gene Information

• Gene Name: CHMP5 charged multivesicular body protein 5 [ Homo sapiens ]
• Official Symbol: CHMP5
• Synonyms: CHMP5; charged multivesicular body protein 5; C9orf83, chromatin modifying protein 5 , chromosome 9 open reading frame 83 , SNF7DC2; CGI 34; HSPC177; Vps60
• Gene ID: 51510
• mRNA Refseq: NM_001195536
• Protein Refseq: NP_001182465
• MIM: 610900
• Uniprot ID: Q9NZZ3
• Chromosome Location: 9p13.3
• Pathway: ESCRT-III complex, organism-specific biosystem; Endocytosis, organism-specific biosystem; Endocytosis, conserved biosystem; Endosomal Sorting Complex Required For Transport (ESCRT), organism-specific biosystem; Membrane Trafficking, organism-specific biosystem
• Function: protein binding