Recombinant Human CHMP4A Protein, GST-Tagged

• Cat.No.: CHMP4A-1252H
• Product Overview: Human CHMP4A full-length ORF (ADR82892.1, 1 a.a. - 265 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: CHMP4A belongs to the chromatin-modifying protein/charged multivesicular body protein (CHMP) family. These proteins are components of ESCRT-III (endosomal sorting complex required for transport III), a complex involved in degradation of surface receptor proteins and formation of endocytic multivesicular bodies (MVBs). Some CHMPs have both nuclear and cytoplasmic/vesicular distributions, and one such CHMP, CHMP1A (MIM 164010), is required for both MVB formation and regulation of cell cycle progression (Tsang et al., 2006 [PubMed 16730941]).[supplied by OMIM, Mar 2008]
• Molecular Mass: 29.2 kDa
• AA Sequence: MSRRRPEDGLGKAGPCVMRHHPPRSKAEVWRTLRGGGGRGELAMSGLGRLFGKGKKEKGPTPEEAIQKLKETEKILIKKQEFLEQKIQQELQTAKKYGTKNKRAALQALRRKKRFEQQLAQTDGTLSTLEFQREAIENATTNAEVLRTMELAAQSMKKAYQDMDIDKVDELMTDITEQQEVAQQISDAISRPMGFGDDVDEDELLEELEELEQEELAQELLNVGDKEEEPSVKLPSVPSTHLPAGPAPKVDEDEEALKQLAEWVS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CHMP4A charged multivesicular body protein 4A [ Homo sapiens ]
• Official Symbol: CHMP4A
• Synonyms: CHMP4A; charged multivesicular body protein 4A; C14orf123, chromatin modifying protein 4A, chromosome 14 open reading frame 123; charged multivesicular body protein 4a; HSPC134; VPS32A; chromatin modifying protein 4A; SNF7 homolog associated with Alix-2; Snf7 homologue associated with Alix 2; vacuolar protein sorting-associated protein 32-1; SNF7; CHMP4; SHAX2; CHMP4B; SNF7-1; VPS32-1; C14orf123; FLJ61658; MGC142093; MGC142095
• Gene ID: 29082
• mRNA Refseq: NM_014169
• Protein Refseq: NP_054888
• MIM: 610051
• UniProt ID: Q9BY43