Recombinant Human CHMP4A Protein

• Cat.No.: CHMP4A-1251H
• Product Overview: Human CHMP4A (NP_054888, 1 a.a.- 265 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• Description: CHMP4A belongs to the chromatin-modifying protein/charged multivesicular body protein (CHMP) family. These proteins are components of ESCRT-III (endosomal sorting complex required for transport III), a complex involved in degradation of surface receptor proteins and formation of endocytic multivesicular bodies (MVBs). Some CHMPs have both nuclear and cytoplasmic/vesicular distributions, and one such CHMP, CHMP1A (MIM 164010), is required for both MVB formation and regulation of cell cycle progression (Tsang et al., 2006 [PubMed 16730941]).[supplied by OMIM, Mar 2008]
• Form: Liquid
• Molecular Mass: 32 kDa
• AA Sequence: MGSSHHHHHHSSGLVPRGSHMSRRRPEDGLGKAGPCVMRHHPPRSKAEVWRTLRGGGGRGELAMSGLGRLFGKGKKEKGPTPEEAIQKLKETEKILIKKQEFLEQKIQQELQTAKKYGTKNKRAALQALRRKKRFEQQLAQTDGTLSTLEFQREAIENATTNAEVLRTMELAAQSMKKAYQDMDIDKVDELMTDITEQQEVAQQISDAISRPMGFGDDVDEDELLEELEELEQEELAQELLNVGDKEEEPSVKLPSVPSTHLPAGPAPKVDEDEEALKQLAEWVS
• Purity: > 90% by SDS-PAGE
• Applications: SDS-PAGE
• Storage: Store at -20 centigrade. For long term storage store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Concentration: 0.25 mg/mL
• Storage Buffer: In 20 mM Tris-HCl, 200 mM NaCl, pH 8.0 (2 mM DTT, 50% glycerol, 0.1 mM PMSF, 1 mM EDTA)

Gene Information

• Gene Name: CHMP4A charged multivesicular body protein 4A [ Homo sapiens ]
• Official Symbol: CHMP4A
• Synonyms: CHMP4A; charged multivesicular body protein 4A; C14orf123, chromatin modifying protein 4A, chromosome 14 open reading frame 123; charged multivesicular body protein 4a; HSPC134; VPS32A; chromatin modifying protein 4A; SNF7 homolog associated with Alix-2; Snf7 homologue associated with Alix 2; vacuolar protein sorting-associated protein 32-1; SNF7; CHMP4; SHAX2; CHMP4B; SNF7-1; VPS32-1; C14orf123; FLJ61658; MGC142093; MGC142095
• Gene ID: 29082
• mRNA Refseq: NM_014169
• Protein Refseq: NP_054888
• MIM: 610051
• UniProt ID: Q9BY43