Recombinant Human CHL1 Protein, GST-Tagged

• Cat.No.: CHL1-1244H
• Product Overview: Human CHL1 partial ORF (NP_006605, 26 a.a. - 135 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene is a member of the L1 gene family of neural cell adhesion molecules. It is a neural recognition molecule that may be involved in signal transduction pathways. The deletion of one copy of this gene may be responsible for mental defects in patients with 3p- syndrome. This protein may also play a role in the growth of certain cancers. Alternate splicing results in both coding and non-coding variants. [provided by RefSeq, Nov 2011]
• Molecular Mass: 37.84 kDa
• AA Sequence: EIPSSVQQVPTIIKQSKVQVAFPFDEYFQIECEAKGNPEPTFSWTKDGNPFYFTDHRIIPSNNSGTFRIPNEGHISHFQGKYRCFASNKLGIAMSEEIEFIVPSVPKFPK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CHL1 cell adhesion molecule with homology to L1CAM (close homolog of L1) [ Homo sapiens ]
• Official Symbol: CHL1
• Synonyms: CHL1; cell adhesion molecule with homology to L1CAM (close homolog of L1); cell adhesion molecule with homology to L1CAM (close homologue of L1); neural cell adhesion molecule L1-like protein; CALL; cell adhesion molecule L1 like; FLJ44930; L1CAM2; MGC132578; neural cell adhesion molecule; close homolog of L1; L1 cell adhesion molecule 2; FLJ30674; DKFZp547L174
• Gene ID: 10752
• mRNA Refseq: NM_001253387
• Protein Refseq: NP_001240316
• MIM: 607416
• UniProt ID: O00533