Recombinant Human CHKB Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: CHKB-4578H
• Product Overview: CHKB MS Standard C13 and N15-labeled recombinant protein (NP_689466) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: Choline kinase (CK) and ethanolamine kinase (EK) catalyze the phosphorylation of choline/ethanolamine to phosphocholine/phosphoethanolamine. This is the first enzyme in the biosynthesis of phosphatidylcholine/phosphatidylethanolamine in all animal cells. The highly purified CKs from mammalian sources and their recombinant gene products have been shown to have EK activity also, indicating that both activities reside on the same protein. The choline kinase-like protein encoded by CHKL belongs to the choline/ethanolamine kinase family; however, its exact function is not known. Read-through transcripts are expressed from this locus that include exons from the downstream CPT1B locus.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 13.3 kDa
• AA Sequence: MAAEATAVAGSGAVGGCLAKDGLQQSKCPDTTPKRRRASSLSRDAERRAYQWCREYLGGAWRRVQPEELRVYPVRWEVRGQPLRCADRGQGSAAGPSGCSMFSPPSCARAWGGAGPAWPGGGRGRGRTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: CHKB choline kinase beta [ Homo sapiens (human) ]
• Official Symbol: CHKB
• Synonyms: CHKB; choline kinase beta; CHKL, choline kinase like; choline/ethanolamine kinase; CHETK; ethanolamine kinase beta; choline kinase-like protein; CK; EK; CKB; EKB; CHKL; CKEKB; MDCMC
• Gene ID: 1120
• mRNA Refseq: NM_152253
• Protein Refseq: NP_689466
• MIM: 612395
• UniProt ID: Q9Y259