Recombinant Human CXCL2 Protein, His tagged

Cat.No. : CXCL2-224H
Product Overview : Recombinant Human CXCL2 Protein (35-107 aa) with His tag was expressed in E.coli.
Availability December 15, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 35-107 aa
Description : This antimicrobial gene is part of a chemokine superfamily that encodes secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies based on the arrangement of the N-terminal cysteine residues of the mature peptide. This chemokine, a member of the CXC subfamily, is expressed at sites of inflammation and may suppress hematopoietic progenitor cell proliferation.
Form : Sterile PBS, pH7.4, 10% Glycerol
Molecular Mass : 10 kDa
AASequence : MGSSHHHHHHSSGLVPRGSHMAPLATELRCQCLQTLQGILKNIQSVKVKSPGPHCAQTVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN
Endotoxin : < 1 EU/μg by LAL
Purity : >90% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 0.8 mg/mL by BCA
Gene Name CXCL2 chemokine (C-X-C motif) ligand 2 [ Homo sapiens (human) ]
Official Symbol CXCL2
Synonyms CXCL2; chemokine (C-X-C motif) ligand 2; GRO2, GRO2 oncogene; C-X-C motif chemokine 2; CINC 2a; GROb; MGSA b; MIP 2a; SCYB2; gro-beta; MGSA beta; MIP2-alpha; GRO2 oncogene; growth-regulated protein beta; macrophage inflammatory protein 2-alpha; melanoma growth stimulatory activity beta; GRO2; MIP2; MIP2A; MGSA-b; MIP-2a; CINC-2a
Gene ID 2920
mRNA Refseq NM_002089
Protein Refseq NP_002080
MIM 139110
UniProt ID P19875

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CXCL2 Products

Required fields are marked with *

My Review for All CXCL2 Products

Required fields are marked with *

0
cart-icon
0
compare icon