Recombinant Human chemokine (C-X-C motif) ligand 2, His-tagged

• Cat.No.: CXCL2-224H
• Product Overview: GRO-Beta Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide ch- ain containing 94 amino acids and having a molecular mass of 10.1 kDa. The GRO-b is fused to 20 amino acid His Tag at N-terminus and purified by proprietary chromatographic techniques.

Specification

• Species: Human
• Source: Human
• Tag: His
• Description: Chemokine (C-X-C motif) ligand 2 (CXCL2) is a small cytokine belonging to the CXC chemokine family that is also called macrophage inflammatory protein 2-alpha (MIP2-alpha), Growth-regulated protein beta (Gro-beta) and Gro oncogene-2 (Gro-2). CXCL2 is 90% identical in amino acid sequence as a related chemokine, CXCL1. This chemokine is secreted by monocytes and macrophages and is chemotactic for polymorphonuclear leukocytes and hematopoietic stem cells. The gene for CXCL2 is located on human chromosome 4 in a cluster of other CXC chemokines. CXCL2 mobilizes cells by interacting with a cell surface chemokine receptor called CXCR2.
• Form: The Human CXCL2 protein solution contains 20mM Tris HCl.
• Purity: Greater than 95.0% as determined by SDS-PAGE.
• Physical Appearance: Sterile filtered colorless solution.
• Amino acid sequence: MGSSHHHHHHSSGLVPRGSHMAPLATELRCQCLQTLQGILKNIQSVK VKSPGPHCAQTVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN
• Storage: Lyophilized Bone Morphogenetic Protein-2 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution BMP2 should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.

Gene Information

• Gene Name: CXCL2 chemokine (C-X-C motif) ligand 2 [ Homo sapiens ]
• Official Symbol: CXCL2
• Synonyms: CXCL2; GRO2; GROb; MIP2; MIP2A; SCYB2; MGSA-b; MIP-2a; CINC-2a; MIP2-alpha; MIP-2a; Gro-beta; C-X-C motif chemokine 2; GRO2 oncogene; Growth-regulated protein beta; MGSA beta; chemokine (C-X-C motif) ligand 2; melanoma growth stimulatory activity beta; MIP2A_HUMAN; Macrophage inflammatory protein 2-alpha [Precursor]; Gro-beta
• Gene ID: 2920
• mRNA Refseq: NM_002089
• Protein Refseq: NP_002080
• MIM: 139110
• UniProt ID: P19875
• Chromosome Location: 4q21
• Pathway: Cytokine-cytokine receptor interaction
• Function: chemokine activity