Active Recombinant Mouse Cxcl2 Protein (73 aa)

• Cat.No.: Cxcl2-020C
• Product Overview: Recombinant Mouse Cxcl2 Protein without tag was expressed in E. coli.

Specification

• Description: Macrophage Inflammatory Protein 2 (MIP-2) was originally identified as a heparin binding protein secreted from a murine macrophage cell line in response to endotoxin stimulation. Based on its protein and DNA sequences, MIP-2 is a member of the alpha (CXC) subfamily of chemokines. Similarly to other alpha chemokines, murine MIP-2 is a potent neutrophil attractant and activator. MIP-2 and KC can bind the murine interleukin 8 type B receptor homologue with high affinity. The expression of MIP-2 was found to be associated with neutrophil influx in pulmonary inflammation and glomerulonephritis, suggesting that MIP-2 may contribute to the pathogenesis of inflammatory diseases.
• Source: E. coli
• Species: Mouse
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: Fully biologically active when compared to standard. Determined by its ability to chemoattract total human neutrophils using a concentration range of 1.0-10.0 ng/mL, corresponding to a Specific Activity of ＞1 × 10^5 IU/mg.
• Molecular Mass: 7.8 kDa, a single, non-glycosylated polypeptide chain containing 73 amino acids.
• Protein length: 73
• AA Sequence: AVVASELRCQCLKTLPRVDFKNIQSLSVTPPGPHCAQTEVIATLKGGQKVCLDPEAPLVQKIIQKILNKGKAN
• Endotoxin: Less than 1 EU/mg of rMuMIP-2/CXCL2 as determined by LAL method.
• Purity: >97% by SDS-PAGE and HPLC analyses.
• Storage: This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles.
• Storage Buffer: Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH 7.4, 150mM NaCl.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: Cxcl2 chemokine (C-X-C motif) ligand 2 [ Mus musculus ]
• Official Symbol: Cxcl2
• Synonyms: CXCL2; chemokine (C-X-C motif) ligand 2; C-X-C motif chemokine 2; macrophage inflammatory protein 2; small inducible cytokine subfamily, member 2; GROb; Gro2; Mip2; Scyb; MIP-2; Scyb2; MIP-2a; Mgsa-b; CINC-2a
• Gene ID: 20310
• mRNA Refseq: NM_009140
• Protein Refseq: NP_033166
• UniProt ID: P10889