Recombinant Human CHAD Protein, GST-Tagged
Cat.No. : | CHAD-1201H |
Product Overview : | Human CHAD full-length ORF (AAH36360.1, 1 a.a. - 359 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Chondroadherin is a cartilage matrix protein thought to mediate adhesion of isolated chondrocytes. The protein contains 11 leucine-rich repeats flanked by cysteine-rich regions. The chondroadherin messenger RNA is present in chondrocytes at all ages. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 65.89 kDa |
AA Sequence : | MVRPMLLLSLGLLAGLLPALAACPQNCHCHSDLQHVICDKVGLQKIPKVSEKTKLLNLQRNNFPVLAANSFRAMPNLVSLHLQHCQIREVAAGAFRGLKQLIYLYLSHNDIRVLRAGAFDDLTELTYLYLDHNKVTELPRGLLSPLVNLFILQLNNNKIRELRAGAFQGAKDLRWLYLSENALSSLQPGALDDVENLAKFHVDRNQLSSYPSAALSKLRVVEELKLSHNPLKSIPDNAFQSFGRYLETLWLDNTNLEKFSDGAFLGVTTLKHVHLENNRLNQLPSNFPFDSLETLALTNNPWKCTCQLRGLRRWLEAKASRPDATCASPAKFKGQHIRDTDAFRSCKFPTKRSKKAGRH |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CHAD chondroadherin [ Homo sapiens ] |
Official Symbol | CHAD |
Synonyms | CHAD; chondroadherin; chondroadherin proteoglycan; SLRR4A; cartilage leucine-rich protein; |
Gene ID | 1101 |
mRNA Refseq | NM_001267 |
Protein Refseq | NP_001258 |
MIM | 602178 |
UniProt ID | O15335 |
◆ Recombinant Proteins | ||
CHAD-67H | Recombinant Human CHAD, His-tagged | +Inquiry |
CHAD-1201H | Recombinant Human CHAD Protein, GST-Tagged | +Inquiry |
CHAD-3308HF | Recombinant Full Length Human CHAD Protein, GST-tagged | +Inquiry |
CHAD-1706H | Recombinant Human CHAD Protein (Cys23-His359), C-His tagged | +Inquiry |
CHAD-49H | Recombinant Human CHAD protein, T7/His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CHAD-182HCL | Recombinant Human CHAD lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CHAD Products
Required fields are marked with *
My Review for All CHAD Products
Required fields are marked with *
0
Inquiry Basket