Recombinant Human CHAD protein, T7/His-tagged

• Cat.No.: CHAD-49H
• Product Overview: Recombinant mature form of human CHAD gene cDNA (23 - 359aa, derived from BC036360) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&T7
• Protein Length: 23-359 a.a.
• Form: 0.25 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
• AA Sequence: MASMTGGQQMGRGHHHHHHGNLYFQGGEFCPQNCHCHSDLQHVICDKVGLQKIPKVSEKTKLLNLQRNNFPVLAA NSFRAMPNLVSLHLQHCQIREVAAGAFRGLKQLIYLYLSHNDIRVLRAGAFDDLTELTYLYLDHNKVTELPRGLL SPLVNLFILQLNNNKIRELRAGAFQGAKDLRWLYLSENALSSLQPGALDDVENLAKFHVDRNQLSSYPSAALSKL RVVEELKLSHNPLKSIPDNAFQSFGRYLETLWLDNTNLEKFSDGAFLGVTTLKHVHLENNRLNQLPSNFPFDSLE TLALTNNPWKCTCQLRGLRRWLEAKASRPDATCASPAKFKGQHIRDTDAFRSCKFPTKRSKKAGRH
• Purity: >90% by SDS-PAGE
• Applications: 1. May be used for in vitro CHAD mediated chondrocytes differentiation regulation study with this protein as either coating matrix protein or soluble factor.2. May be used as CHAD protein-protein interaction assay.3. As enzymatic substrate for various proteases.4. As native (non-glycosilated) antigen for specific antibody production.
• Storage: Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.

Gene Information

• Gene Name: CHAD chondroadherin [ Homo sapiens ]
• Official Symbol: CHAD
• Synonyms: CHAD; chondroadherin; chondroadherin proteoglycan; SLRR4A; cartilage leucine-rich protein
• Gene ID: 1101
• mRNA Refseq: NM_001267
• Protein Refseq: NP_001258
• MIM: 602178
• UniProt ID: O15335
• Chromosome Location: 17q21.33
• Pathway: ECM-receptor interaction, organism-specific biosystem; ECM-receptor interaction, conserved biosystem; Focal Adhesion, organism-specific biosystem; Focal adhesion, organism-specific biosystem; Focal adhesion, conserved biosystem
• Function: extracellular matrix structural constituent