Recombinant Human CEP290 Protein, GST-Tagged

Cat.No. : CEP290-1134H
Product Overview : Human Cep290 full-length ORF (AAH08641.1, 1 a.a. - 164 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a protein with 13 putative coiled-coil domains, a region with homology to SMC chromosome segregation ATPases, six KID motifs, three tropomyosin homology domains and an ATP/GTP binding site motif A. The protein is localized to the centrosome and cilia and has sites for N-glycosylation, tyrosine sulfation, phosphorylation, N-myristoylation, and amidation. Mutations in this gene have been associated with Joubert syndrome and nephronophthisis and the presence of antibodies against this protein is associated with several forms of cancer. [provided by RefSeq, Jul 2008]
Molecular Mass : 45.6 kDa
AA Sequence : MAIFKIAALQKVVDNSVSLSELELANKQYNELTAKYRDILQKDNMLVQRTSNLEHLECENISLKEQVESINKELEITKEKLHTIEQAWEQETKLGNESSMDKAKKSITNSDIVSISKKITMLEMKELNERQRAEHCQKMYEHLRTSLKQMEERNFELETKFAEV
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CEP290 centrosomal protein 290kDa [ Homo sapiens ]
Official Symbol CEP290
Synonyms CEP290; centrosomal protein 290kDa; centrosomal protein of 290 kDa; 3H11Ag; BBS14; cancer/testis antigen 87; CT87; FLJ13615; JBTS5; Joubert syndrome 5; KIAA0373; LCA10; Meckel syndrome; type 4; MKS4; nephrocystin 6; NPHP6; POC3; POC3 centriolar protein homolog (Chlamydomonas); rd16; SLSN6; nephrocytsin-6; tumor antigen se2-2; Meckel syndrome, type 4; CTCL tumor antigen se2-2; prostate cancer antigen T21; POC3 centriolar protein homolog; Bardet-Biedl syndrome 14 protein; monoclonal 3H11 antigen; FLJ21979;
Gene ID 80184
mRNA Refseq NM_025114
Protein Refseq NP_079390
MIM 610142
UniProt ID O15078

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CEP290 Products

Required fields are marked with *

My Review for All CEP290 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon