Recombinant Human CEP19 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : CEP19-3696H
Product Overview : C3orf34 MS Standard C13 and N15-labeled recombinant protein (NP_116287) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The protein encoded by this gene localizes to centrosomes and primary cilia and co-localizes with a marker for the mother centriole. This gene resides in a region of human chromosome 3 that is linked to morbid obesity. A homozygous knockout of the orthologous gene in mouse resulted in mice with morbid obesity, hyperphagy, glucose intolerance, and insulin resistance. Mutations in this gene cause morbid obesity and spermatogenic failure (MOSPGF). This gene has a pseudogene on human chromosome 2.
Molecular Mass : 19.2 kDa
AA Sequence : MMCTAKKCGIRFQPPAIILIYESEIKGKIRQRIMPVRNFSKFSDCTRAAEQLKNNPRHKSYLEQVSLRQLEKLFSFLRGYLSGQSLAETMEQIQRETTIDPEEDLNKLDDKELAKRKSIMDELFEKNQKKKDDPNFVYDIEVEFPQDDQLQSCGWDTESADEFTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name CEP19 centrosomal protein 19kDa [ Homo sapiens (human) ]
Official Symbol CEP19
Synonyms CEP19; centrosomal protein 19kDa; C3orf34, chromosome 3 open reading frame 34; centrosomal protein of 19 kDa; MGC14126; C3orf34;
Gene ID 84984
mRNA Refseq NM_032898
Protein Refseq NP_116287
MIM 615586
UniProt ID Q96LK0

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CEP19 Products

Required fields are marked with *

My Review for All CEP19 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon