Recombinant Human CEP19 Protein, GST-Tagged

• Cat.No.: CEP19-0027H
• Product Overview: Human C3orf34 full-length ORF (BAG36771.1, 1 a.a. - 163 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The protein encoded by this gene localizes to centrosomes and primary cilia and co-localizes with a marker for the mother centriole. This gene resides in a region of human chromosome 3 that is linked to morbid obesity. A homozygous knockout of the orthologous gene in mouse resulted in mice with morbid obesity, hyperphagy, glucose intolerance, and insulin resistance. Mutations in this gene cause morbid obesity and spermatogenic failure (MOSPGF). This gene has a pseudogene on human chromosome 2. [provided by RefSeq, Apr 2014]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 44.33 kDa
• AA Sequence: MMCTAKKCGIRFQPPAIILIYESEIKGKIRQRIMPVRNFSKFSDCTRAAEQLKNNPRHKSYLEQVSLRQLEKLFSFLRGYLSGQSLAETMEQIQRETTIDPEEDLNKLDDKELAKRKSIMDELFEKNQKKKDDPNFVYDIEVEFPQDDQLQSCGWDTESADEF
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CEP19 centrosomal protein 19kDa [ Homo sapiens ]
• Official Symbol: CEP19
• Synonyms: CEP19; centrosomal protein 19kDa; C3orf34, chromosome 3 open reading frame 34; centrosomal protein of 19 kDa; MGC14126; C3orf34
• Gene ID: 84984
• mRNA Refseq: NM_032898
• Protein Refseq: NP_116287
• MIM: 615586
• UniProt ID: Q96LK0