Recombinant Human CENPV Protein, GST-Tagged

• Cat.No.: CENPV-1128H
• Product Overview: Human CENPV full-length ORF (AAH52604.1, 1 a.a. - 275 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: CENPV (Centromere Protein V) is a Protein Coding gene. Diseases associated with CENPV include Intracranial Primitive Neuroectodermal Tumor and Diffuse Glomerulonephritis. GO annotations related to this gene include carbon-sulfur lyase activity. An important paralog of this gene is CENPVL2.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 56.65 kDa
• AA Sequence: MRRSRSSAAAKLRGQKRSGASGASAAPAASAAAALAPSATRTRRSASQAGSKSQAVEKPPSEKPRLRRSSPRAQEEGPGEPPPPELALLPPPPPPPPTPATPTSSASNLDLGEQRERWETFQKRQKLTSEGAAKLLLDTFEYQGLVKHTGGCHCGAVRFEVWASADLHIFDCNCSICKKKQNRHFIVPASRFKLLKGAEHITTYTFNTHKAQHTFCKRCGVQSFYTPRSNPGGFGIAPHCLDEGTVRSMVTEEFNGSDWEKAMKEHKTIKNMSKE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CENPV centromere protein V [ Homo sapiens ]
• Official Symbol: CENPV
• Synonyms: CENPV; centromere protein V; proline rich 6, PRR6; CENP V; p30; proline rich 6; nuclear protein p30; proline-rich protein 6; PRR6; CENP-V; 3110013H01Rik
• Gene ID: 201161
• mRNA Refseq: NM_181716
• Protein Refseq: NP_859067
• MIM: 608139
• UniProt ID: Q7Z7K6