Recombinant Full Length Human CENPV Protein, GST-tagged

Cat.No. : CENPV-3147HF
Product Overview : Human CENPV full-length ORF (AAH52604.1, 1 a.a. - 275 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 275 amino acids
Description : CENPV (Centromere Protein V) is a Protein Coding gene. Diseases associated with CENPV include Intracranial Primitive Neuroectodermal Tumor and Diffuse Glomerulonephritis. GO annotations related to this gene include carbon-sulfur lyase activity. An important paralog of this gene is CENPVL2.
Molecular Mass : 56.65 kDa
AA Sequence : MRRSRSSAAAKLRGQKRSGASGASAAPAASAAAALAPSATRTRRSASQAGSKSQAVEKPPSEKPRLRRSSPRAQEEGPGEPPPPELALLPPPPPPPPTPATPTSSASNLDLGEQRERWETFQKRQKLTSEGAAKLLLDTFEYQGLVKHTGGCHCGAVRFEVWASADLHIFDCNCSICKKKQNRHFIVPASRFKLLKGAEHITTYTFNTHKAQHTFCKRCGVQSFYTPRSNPGGFGIAPHCLDEGTVRSMVTEEFNGSDWEKAMKEHKTIKNMSKE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CENPV centromere protein V [ Homo sapiens ]
Official Symbol CENPV
Synonyms CENPV; centromere protein V; proline rich 6, PRR6; CENP V; p30; proline rich 6; nuclear protein p30; proline-rich protein 6; PRR6; CENP-V; 3110013H01Rik;
Gene ID 201161
mRNA Refseq NM_181716
Protein Refseq NP_859067
MIM 608139
UniProt ID Q7Z7K6

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CENPV Products

Required fields are marked with *

My Review for All CENPV Products

Required fields are marked with *

0

Inquiry Basket

cartIcon