Recombinant Human CENPP Protein, GST-Tagged

• Cat.No.: CENPP-1124H
• Product Overview: Human CENPP full-length ORF (NP_001012267.1, 1 a.a. - 288 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: CENPP is a subunit of a CENPH (MIM 605607)-CENPI (MIM 300065)-associated centromeric complex that targets CENPA (MIM 117139) to centromeres and is required for proper kinetochore function and mitotic progression (Okada et al., 2006 [PubMed 16622420]).[supplied by OMIM, Mar 2008]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 59.6 kDa
• AA Sequence: MDAELAEVRALQAEIAALRRACEDPPAPWEEKSRVQKSFQAIHQFNLEGWKSSKDLKNQLGHLESELSFLSTLTGINIRNHSKQTEDLTSTEMTEKSIRKVLQRHRLSGNCHMVTFQLEFQILEIQNKERLSSAVTDLNIIMEPTECSELSEFVSRAEERKDLFMFFRSLHFFVEWFEYRKRTFKHLKEKYPDAVYLSEGPSSCSMGIRSASRPGFELVIVWRIQIDEDGKVFPKLDLLTKVPQRALELDKNRAIETAPLSFRTLVGLLGIEAALESLIKSLCAEENN
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CENPP centromere protein P [ Homo sapiens ]
• Official Symbol: CENPP
• Synonyms: CENPP; centromere protein P; CENP P; RP11 19J3.3; CENP-P; RP11-19J3.3; FLJ33928
• Gene ID: 401541
• mRNA Refseq: NM_001012267
• Protein Refseq: NP_001012267
• MIM: 611505
• UniProt ID: Q6IPU0