Recombinant Human CENPB protein(501-590 aa), N-MBP & C-His-tagged

• Cat.No.: CENPB-2577H
• Product Overview: Recombinant Human CENPB protein(P07199)(501-590 aa), fused with N-terminal MBP tag and C-terminal His tag, was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: His&MBP
• Protein Length: 501-590 aa
• Form: 0.15 M Phosphate buffered saline
• Molecular Mass: 53.5 kDa
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: LHFLEGGEDSDSDSEEEDDEEEDDEDEDDDDDEEDGDEVPVPSFGEAMAYFAMVKRYLTSFPIDDRVQSHILHLEHDLVHVTRKNHARQA

Gene Information

• Gene Name: CENPB centromere protein B, 80kDa [ Homo sapiens ]
• Official Symbol: CENPB
• Synonyms: CENPB; centromere protein B, 80kDa; centromere protein B (80kD); major centromere autoantigen B; CENP-B; centromere autoantigen B
• Gene ID: 1059
• mRNA Refseq: NM_001810
• Protein Refseq: NP_001801
• MIM: 117140
• UniProt ID: P07199