Recombinant Human CELF1 protein(T173E,S178D,S285D,S288D,S295D,S296D,S298D)

• Cat.No.: CELF1-707H
• Product Overview: Recombinant Human CELF1 protein(Q92879)(1-475aa (T173E,S178D,S285D,S288D,S295D,S296D,S298D)), was expressed in E. coli.

Specification

• Source: E.coli
• Species: Human
• Tag: Non
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 53.0 kDa
• Protein length: 1-475aa (T173E,S178D,S285D,S288D,S295D,S296D,S298D)
• AA Sequence: MNGTLDHPDQPDLDAIKMFVGQVPRTWSEKDLRELFEQYGAVYEINVLRDRSQNPPQSKGCCFVTFYTRKAALEAQNALHNMKVLPGMHHPIQMKPADSEKNNAVEDRKLFIGMISKKCTENDIRVMFSSFGQIEECRMLRGPDGLSRGCAFVTFTTRAMAQTAIKAMHQAQEMEGCDSPMVVKFADTQKDKEQKRMAQQLQQQMQQISAASVWGNLAGLNTLGPQYLALLQQTASSGNLNTLSSLHPMGGLNAMQLQNLAALAAAASAAQNTPSGTNALTTSSDPLDVLTSSGDDPDSSSSNSVNPIASLGALQTLAGATAGLNVGSLAGMAALNGGLGSSGLSNGTGSTMEALTQAYSGIQQTLYNQNLLTQQSIGAAGSQKEGPEGANLFIYHLPQEFGDQDLLQMFMPFGNVVSAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQSMNGFQIGMKRLKVQLKRSKNDSKPY
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: CELF1 CUGBP, Elav-like family member 1 [ Homo sapiens ]
• Official Symbol: CELF1
• Synonyms: CELF1; CUGBP, Elav-like family member 1; CUG triplet repeat, RNA binding protein 1 , CUG triplet repeat, RNA binding protein 1 , CUGBP1; CUGBP Elav-like family member 1; bruno like 2; BRUNOL2; CUG RNA binding protein; CUG BP; CUGBP; EDEN BP; embryo deadenylation element binding protein; hNab50; NAB50; NAPOR; nuclear polyadenylated RNA binding protein; 50 kD; CELF-1; CUG-BP1; bruno-like 2; EDEN-BP homolog; bruno-like protein 2; CUG RNA-binding protein; deadenylation factor CUG-BP; RNA-binding protein BRUNOL-2; CUG-BP- and ETR-3-like factor 1; CUG triplet repeat RNA-binding protein 1; CUG triplet repeat, RNA binding protein 1; CUG triplet repeat, RNA-binding protein 1; 50 kDa nuclear polyadenylated RNA-binding protein; nuclear polyadenylated RNA-binding protein, 50-kD; embryo deadenylation element-binding protein homolog; CUG-BP; CUGBP1; EDEN-BP
• Gene ID: 10658
• mRNA Refseq: NM_001025596
• Protein Refseq: NP_001020767
• MIM: 601074
• UniProt ID: Q92879