Recombinant Human CEACAM7 Protein, His-SUMO-tagged

• Cat.No.: CEACAM7-1161H
• Product Overview: Recombinant Human CEACAM7 Protein (36-242aa) was expressed in E. coli with N-terminal 6xHis-SUMO-tag.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 36-242 a.a.
• Form: Tris-based buffer, 50% glycerol.
• Molecular Mass: 39.4 kDa
• AA Sequence: TNIDVVPFNVAEGKEVLLVVHNESQNLYGYNWYKGERVHANYRIIGYVKNISQENAPGPAHNGRETIYPN
  GTLLIQNVTHNDAGFYTLHVIKENLVNEEVTRQFYVFSEPPKPSITSNNFNPVENKDIVVLTCQPETQNT
  TYLWWVNNQSLLVSPRLLLSTDNRTLVLLSATKNDIGPYECEIQNPVGASRSDPVTLNVRYESVQAS
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.

Gene Information

• Gene Name: CEACAM7 carcinoembryonic antigen-related cell adhesion molecule 7 [ Homo sapiens ]
• Official Symbol: CEACAM7
• Synonyms: CEACAM7; carcinoembryonic antigen-related cell adhesion molecule 7; CGM2; carcinoembryonic antigen gene family member 2; CEA; carcinoembryonic antigen CGM2
• Gene ID: 1087
• mRNA Refseq: NM_006890
• Protein Refseq: NP_008821
• UniProt ID: Q14002