Recombinant Human CEACAM7, His-tagged

• Cat.No.: CEACAM7-63H
• Product Overview: Recombinant Human Carcinoembryonic Antigen-Related Cell Adhesion Molecule 7/CEACAM7 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Thr36-Phe142) of Human CEACAM7 fused with a polyhistidine tag at the C-terminus.

Specification

• Description: Carcinoembryonic Antigen-Related Cell Adhesion Molecule 7 (CEACAM7) is a member of the immunoglobulin superfamily A and CEA family. CEACAM7 localizes to the cell membrane and contains one Ig-like C2-type domain and one Ig-like V-type domain. The expression of CEACAM7 is significantly decreased in rectal cancer. Differences in CEACAM7 expression levels between long-term survivors and those with recurrent disease introduce a potential tumor marker to define a subset of patients who benefit most from adjuvant therapy.
• Source: HEK293
• Species: Human
• Tag: His
• AA Sequence: NIDVVPFNVAEGKEVLLVVHNESQNLYGYNWYKGERVHANYRIIGYVKNISQENAPGPAHNGRET IYPNGTLLIQNVTHNDAGIYTLHVIKENLVNEEVTRQFYVFVDHHHHHH
• Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
• Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
• Protein length: 36-142 a.a.

Gene Information

• Gene Name: CEACAM7 carcinoembryonic antigen-related cell adhesion molecule 7 [ Homo sapiens ]
• Official Symbol: CEACAM7
• Synonyms: CEACAM7; carcinoembryonic antigen-related cell adhesion molecule 7; CGM2; carcinoembryonic antigen gene family member 2; CEA; carcinoembryonic antigen CGM2
• Gene ID: 1087
• mRNA Refseq: NM_006890
• Protein Refseq: NP_008821
• UniProt ID: Q14002
• Chromosome Location: 19q13.2