Recombinant Full Length Human CEACAM7 Protein, C-Flag-tagged
Cat.No. : | CEACAM7-1835HFL |
Product Overview : | Recombinant Full Length Human CEACAM7 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a cell surface glycoprotein and member of the carcinoembryonic antigen (CEA) family of proteins. Expression of this gene may be downregulated in colon and rectal cancer. Additionally, lower expression levels of this gene may be predictive of rectal cancer recurrence. This gene is present in a CEA family gene cluster on chromosome 19. Alternative splicing results in multiple transcript variants. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 29.2 kDa |
AA Sequence : | MGSPSACPYRVCIPWQGLLLTASLLTFWNLPNSAQTNIDVVPFNVAEGKEVLLVVHNESQNLYGYNWYKG ERVHANYRIIGYVKNISQENAPGPAHNGRETIYPNGTLLIQNVTHNDAGIYTLHVIKENLVNEEVTRQFY VFSEPPKPSITSNNFNPVENKDIVVLTCQPETQNTTYLWWVNNQSLLVSPRLLLSTDNRTLVLLSATKND IGPYECEIQNPVGASRSDPVTLNVRYESVQASSPDLSAGTAVSIMIGVLAGMALI myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | CEACAM7 CEA cell adhesion molecule 7 [ Homo sapiens (human) ] |
Official Symbol | CEACAM7 |
Synonyms | CGM2 |
Gene ID | 1087 |
mRNA Refseq | NM_006890.5 |
Protein Refseq | NP_008821.2 |
MIM | 619160 |
UniProt ID | Q14002 |
◆ Recombinant Proteins | ||
CEACAM7-572H | Recombinant Human CEACAM7 Protein, His (Fc)-Avi-tagged | +Inquiry |
CEACAM7-1835HFL | Recombinant Full Length Human CEACAM7 Protein, C-Flag-tagged | +Inquiry |
CEACAM7-7614H | Recombinant Human CEACAM7, His-tagged | +Inquiry |
CEACAM7-1006H | Recombinant Human CEACAM7 Protein (Thr36-Phe142), C-His tagged | +Inquiry |
CEACAM7-63H | Recombinant Human CEACAM7, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CEACAM7-179HCL | Recombinant Human CEACAM7 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CEACAM7 Products
Required fields are marked with *
My Review for All CEACAM7 Products
Required fields are marked with *
0
Inquiry Basket