Recombinant Human CEACAM4 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: CEACAM4-2278H
• Product Overview: CEACAM4 MS Standard C13 and N15-labeled recombinant protein (NP_001808) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: Granulocyte orphan receptor that acts as an trigger efficient phagocytosis of attached particles.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 25.7 kDa
• AA Sequence: MGPPSAAPRGGHRPWQGLLITASLLTFWHPPTTVQFTIEALPSSAAEGKDVLLLACNISETIQAYYWHKGKTAEGSPLIAGYITDIQANIPGAAYSGRETVYPNGSLLFQNITLEDAGSYTLRTINASYDSDQATGQLHVHQNNVPGLPVGAVAGIVTGVLVGVALVAALVCFLLLSRTGRASIQRDLREQPPPASTPGHGPSHRSTFSAPLPSPRTATPIYEELLYSDANIYCQIDHKADVVSTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: CEACAM4 carcinoembryonic antigen-related cell adhesion molecule 4 [ Homo sapiens (human) ]
• Official Symbol: CEACAM4
• Synonyms: CEACAM4; carcinoembryonic antigen-related cell adhesion molecule 4; CGM7; carcinoembryonic antigen CGM7; nonspecific cross-reacting antigen W236; Nonspecific cross-reacting antigen (NCA); non-specific cross-reacting antigen W236; carcinoembryonic antigen gene family member 7; NCA; CGM7_HUMAN
• Gene ID: 1089
• mRNA Refseq: NM_001817
• Protein Refseq: NP_001808
• UniProt ID: O75871