Recombinant Human CEACAM4 protein, His-tagged

• Cat.No.: CEACAM4-12H
• Product Overview: Recombinant Human CEACAM4(36-155aa) fused with His tag was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Form: Tris-based buffer, 50% glycerol
• Molecular Mass: 14.6kD
• AA Sequence: FTIEALPSSAAEGKDVLLLACNISETIQAYYWHKGKTAEGSPLIAGYITDIQANIPGAAYSGRETVYPNGSLLFQNITLEDAGSYTLRTINASYDSDQATGQLHVHQNNVPGLPVGAVAG
• Purity: >90% (SDS-PAGE)
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
  Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Protein length: 36-155 a.a.

Gene Information

• Gene Name: CEACAM4 carcinoembryonic antigen-related cell adhesion molecule 4 [ Homo sapiens ]
• Official Symbol: CEACAM4
• Synonyms: CEACAM4; carcinoembryonic antigen-related cell adhesion molecule 4; CGM7; carcinoembryonic antigen CGM7; nonspecific cross-reacting antigen W236; Nonspecific cross-reacting antigen (NCA); non-specific cross-reacting antigen W236; carcinoembryonic antigen gene family member 7; NCA; CGM7_HUMAN
• Gene ID: 1089
• mRNA Refseq: NM_001817
• Protein Refseq: NP_001808
• UniProt ID: O75871
• Chromosome Location: 19q13.2