Recombinant Human CDX1 Protein, GST-Tagged

• Cat.No.: CDX1-1082H
• Product Overview: Human CDX1 partial ORF (NP_001795, 126 a.a. - 215 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene is a member of the caudal-related homeobox transcription factor gene family. The encoded DNA-binding protein regulates intestine-specific gene expression and enterocyte differentiation. It has been shown to induce expression of the intestinal alkaline phosphatase gene, and inhibit beta-catenin/T-cell factor transcriptional activity. [provided by RefSeq, Jul 2008]
• Molecular Mass: 35.64 kDa
• AA Sequence: GAQRPTPYEWMRRSVAAGGGGGSGKTRTKDKYRVVYTDHQRLELEKEFHYSRYITIRRKSELAANLGLTERQVKIWFQNRRAKERKVNKK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CDX1 caudal type homeobox 1 [ Homo sapiens ]
• Official Symbol: CDX1
• Synonyms: CDX1; caudal type homeobox 1; caudal type homeo box transcription factor 1; homeobox protein CDX-1; caudal-type homeobox protein 1; caudal-type homeobox protein CDX1; caudal type homeobox transcription factor 1; MGC116915
• Gene ID: 1044
• mRNA Refseq: NM_001804
• Protein Refseq: NP_001795
• MIM: 600746
• UniProt ID: P47902