Recombinant Human CDT1 protein, GST-tagged
Cat.No. : | CDT1-105H |
Product Overview : | Recombinant Human CDT1(1 a.a. - 546 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
ProteinLength : | 1 a.a. - 546 a.a. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 86.46 kDa |
AA Sequence : | MEQRRVTDFFARRRPGPPRIAPPKLACRTPSPARPALRAPASATSGSRKRARPPAAPGRDQARPPARRRLRLSVD EVSSPSTPEAPDIPACPSPGQKIKKSTPAAGQPPHLTSAQDQDTISELASCLQRARELGARVRALKASAQDAGES CTPEAEGRPEEPCGEKAPAYQRFHALAQPGLPGLVLPYKYQVLAEMFRSMDTIVGMLHNRSETPTFAKVQRGVQD MMRRRFEERNVGQIKTVYPASYRFRQERSVPTFKDGTRRSDYQLTIEPLLEQEADGAAPQLTASRLLQRRQIFSQ KLVEHVKEHHKAFLASLSPAMVVPEDQLTRWHPRFNVDEVPDIEPAALPQPPATEKLTTAQEVLARARNLISPRM EKALSQLALRSAAPSSPGSPRPALPATPPATPPAASPSALKGVSQDLLERIRAKEAQKQLAQMTRCPEQEQRLQR LERLPELARVLRSVFVSERKPALSMEVACARMVGSCCTIMSPGEMEKHLLLLSELLPDWLSLHRIRTDTYVKLDK AADLAHITARLAHQTRAEEGL |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | CDT1 chromatin licensing and DNA replication factor 1 [ Homo sapiens ] |
Official Symbol | CDT1 |
Synonyms | CDT1; chromatin licensing and DNA replication factor 1; DNA replication factor Cdt1; DUP; RIS2; Double parked, Drosophila, homolog of; |
Gene ID | 81620 |
mRNA Refseq | NM_030928 |
Protein Refseq | NP_112190 |
MIM | 605525 |
UniProt ID | Q9H211 |
Chromosome Location | 16q24.3 |
Pathway | Activation of the pre-replicative complex, organism-specific biosystem; Assembly of the pre-replicative complex, organism-specific biosystem; Association of licensing factors with the pre-replicative complex, organism-specific biosystem; CDT1 association with the CDC6:ORC:origin complex, organism-specific biosystem; Cell Cycle, organism-specific biosystem; Cell Cycle, Mitotic, organism-specific biosystem; DNA Replication, organism-specific biosystem; |
Function | DNA binding; protein binding; |
◆ Recombinant Proteins | ||
TRMT1L-793C | Recombinant Cynomolgus Monkey TRMT1L Protein, His (Fc)-Avi-tagged | +Inquiry |
ANAPC4-323R | Recombinant Rhesus monkey ANAPC4 Protein, His-tagged | +Inquiry |
HADHB-2437R | Recombinant Rat HADHB Protein, His (Fc)-Avi-tagged | +Inquiry |
PHKG1-30332TH | Recombinant Human PHKG1 | +Inquiry |
AKAP9-405H | Recombinant Human AKAP9 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
S100B-257B | Native Bovine S-100b Protein | +Inquiry |
Brain-10H | Native Human Brain Tissue Protein/Lysate | +Inquiry |
IGHG3-120H | Native Human Immunoglobulin G3 | +Inquiry |
RPE-426 | Native RPE | +Inquiry |
Flavin-containing Amine oxidase-010B | Native Bovine Flavin-containing Amine oxidase Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
Heart-562M | MiniPig Heart Lysate, Total Protein | +Inquiry |
Stomach-477C | Cat Stomach Lysate, Total Protein | +Inquiry |
MNT-412HCL | Recombinant Human MNT lysate | +Inquiry |
EFNB3-1264RCL | Recombinant Rat EFNB3 cell lysate | +Inquiry |
EDARADD-6727HCL | Recombinant Human EDARADD 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CDT1 Products
Required fields are marked with *
My Review for All CDT1 Products
Required fields are marked with *
0
Inquiry Basket