Recombinant Human CDKL5 Protein, GST-Tagged

• Cat.No.: CDKL5-1052H
• Product Overview: Human CDKL5 partial ORF (AAH36091, 722 a.a. - 831 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene is a member of Ser/Thr protein kinase family and encodes a phosphorylated protein with protein kinase activity. Mutations in this gene have been associated with X-linked infantile spasm syndrome (ISSX), also known as X-linked West syndrome, and Rett syndrome (RTT). Alternate transcriptional splice variants have been characterized. [provided by RefSeq, Jul 2008]
• Molecular Mass: 37.73 kDa
• AA Sequence: RPDNSFHENNVSTRVSSLPSESSSGTNHSKRQPAFDPWKSPENISHSEQLKEKEKQGFFRSMKKKKKKSQTVPNSDSPDLLTLQKSIHSASTPSSRPKEWRPEKISDLQT
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CDKL5 cyclin-dependent kinase-like 5 [ Homo sapiens ]
• Official Symbol: CDKL5
• Synonyms: CDKL5; cyclin-dependent kinase-like 5; serine/threonine kinase 9, STK9; EIEE2; serine/threonine kinase 9; serine/threonine-protein kinase 9; cyclin dependent kinase 5 transcript; ISSX; STK9
• Gene ID: 6792
• mRNA Refseq: NM_003159
• Protein Refseq: NP_003150
• MIM: 300203
• UniProt ID: O76039