Recombinant Human CDKAL1 Protein, GST-Tagged

• Cat.No.: CDKAL1-1044H
• Product Overview: Human CDKAL1 full-length ORF (AAH64145.1, 1 a.a. - 97 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The protein encoded by this gene is a member of the methylthiotransferase family. The function of this gene is not known. Genome-wide association studies have linked single nucleotide polymorphisms in an intron of this gene with susceptibilty to type 2 diabetes. [provided by RefSeq, May 2010]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 37.4 kDa
• AA Sequence: MPSASCDTLLDDIEDIVSQEDSKPQDRHFVRKDVVPKVRRRNTQKYLQEEENSPPSDSTIPGIQKIWIRTWGCSHNNSDGEYMAGQLAAYGYKITGE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CDKAL1 CDK5 regulatory subunit associated protein 1-like 1 [ Homo sapiens ]
• Official Symbol: CDKAL1
• Synonyms: CDKAL1; CDK5 regulatory subunit associated protein 1-like 1; threonylcarbamoyladenosine tRNA methylthiotransferase; FLJ20342; tRNA-t(6)A37 methylthiotransferase; FLJ46705; MGC75469
• Gene ID: 54901
• mRNA Refseq: NM_017774
• Protein Refseq: NP_060244
• MIM: 611259
• UniProt ID: Q5VV42