Recombinant Human CDK7 protein, His-tagged

• Cat.No.: CDK7-2923H
• Product Overview: Recombinant Human CDK7 protein(183-345 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• ProteinLength: 183-345 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: LLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCARITATQALKMKYFSNRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLI
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: CDK7 cyclin-dependent kinase 7 [ Homo sapiens ]
• Official Symbol: CDK7
• Synonyms: CDK7; cyclin-dependent kinase 7; cyclin dependent kinase 7 (homolog of Xenopus MO15 cdk activating kinase) , cyclin dependent kinase 7 (MO15 homolog, Xenopus laevis, cdk activating kinase); CAK; CAK1; CDKN7; MO15; STK1; p39 Mo15; protein kinase; 39 KDa protein kinase; kinase subunit of CAK; CDK-activating kinase 1; serine/threonine kinase stk1; cell division protein kinase 7; serine/threonine protein kinase 1; serine/threonine-protein kinase 1; serine/threonine protein kinase MO15; homolog of Xenopus MO15 Cdk-activating kinase; TFIIH basal transcription factor complex kinase subunit; cyclin-dependent kinase 7 (MO15 homolog, Xenopus laevis, cdk-activating kinase); HCAK; p39MO15
• Gene ID: 1022
• mRNA Refseq: NM_001799
• Protein Refseq: NP_001790
• MIM: 601955
• UniProt ID: P50613