Recombinant Full Length Human CDK7 Protein, C-Flag-tagged
Cat.No. : | CDK7-939HFL |
Product Overview : | Recombinant Full Length Human CDK7 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a member of the cyclin-dependent protein kinase (CDK) family. CDK family members are highly similar to the gene products of Saccharomyces cerevisiae cdc28, and Schizosaccharomyces pombe cdc2, and are known to be important regulators of cell cycle progression. This protein forms a trimeric complex with cyclin H and MAT1, which functions as a Cdk-activating kinase (CAK). It is an essential component of the transcription factor TFIIH, that is involved in transcription initiation and DNA repair. This protein is thought to serve as a direct link between the regulation of transcription and the cell cycle. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 38.9 kDa |
AA Sequence : | MALDVKSRAKRYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSEAKDGINRTALREIKLLQELS HPNIIGLLDAFGHKSNISLVFDFMETDLEVIIKDNSLVLTPSHIKAYMLMTLQGLEYLHRHWILHRDLKP NNLLLDENGVLKLADFGLAKSFGSPNRAYTHQVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRV PFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNP CARITATQALKMKYFSNRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLIFTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Protein Kinase, Stem cell - Pluripotency, Transcription Factors |
Protein Pathways : | Cell cycle, Nucleotide excision repair |
Full Length : | Full L. |
Gene Name | CDK7 cyclin dependent kinase 7 [ Homo sapiens (human) ] |
Official Symbol | CDK7 |
Synonyms | CAK; CAK1; HCAK; MO15; STK1; CDKN7; p39MO15 |
Gene ID | 1022 |
mRNA Refseq | NM_001799.4 |
Protein Refseq | NP_001790.1 |
MIM | 601955 |
UniProt ID | P50613 |
◆ Recombinant Proteins | ||
Cdk7-1925M | Recombinant Mouse Cdk7 protein, His-tagged | +Inquiry |
CDK7-3164HF | Recombinant Full Length Human CDK7 Protein, GST-tagged | +Inquiry |
CDK7-0810H | Recombinant Human CDK7 Protein (Met1-Phe346), N-His tagged | +Inquiry |
CDK7-31757TH | Recombinant Human Human CDK7, His-tagged | +Inquiry |
CDK7-12210Z | Recombinant Zebrafish CDK7 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDK7-7621HCL | Recombinant Human CDK7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CDK7 Products
Required fields are marked with *
My Review for All CDK7 Products
Required fields are marked with *
0
Inquiry Basket