Recombinant Human CDK6 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | CDK6-3246H |
Product Overview : | CDK6 MS Standard C13 and N15-labeled recombinant protein (NP_001138778) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Description : | The protein encoded by this gene is a member of the CMGC family of serine/threonine protein kinases. This kinase is a catalytic subunit of the protein kinase complex that is important for cell cycle G1 phase progression and G1/S transition. The activity of this kinase first appears in mid-G1 phase, which is controlled by the regulatory subunits including D-type cyclins and members of INK4 family of CDK inhibitors. This kinase, as well as CDK4, has been shown to phosphorylate, and thus regulate the activity of, tumor suppressor protein Rb. Altered expression of this gene has been observed in multiple human cancers. A mutation in this gene resulting in reduced cell proliferation, and impaired cell motility and polarity, and has been identified in patients with primary microcephaly. |
Source : | HEK293 |
Species : | Human |
Tag : | Myc&DDK |
Molecular Mass : | 36.9 kDa |
AA Sequence : | MEKDGLCRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIREVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTETIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVVVTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGEEDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYFQDLERCKENLDSHLPPSQNTSELNTATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | CDK6 cyclin-dependent kinase 6 [ Homo sapiens (human) ] |
Official Symbol | CDK6 |
Synonyms | CDK6; cyclin-dependent kinase 6; PLSTIRE; cell division protein kinase 6; serine/threonine-protein kinase PLSTIRE; MGC59692; |
Gene ID | 1021 |
mRNA Refseq | NM_001145306 |
Protein Refseq | NP_001138778 |
MIM | 603368 |
UniProt ID | Q00534 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CDK6 Products
Required fields are marked with *
My Review for All CDK6 Products
Required fields are marked with *
0
Inquiry Basket