Recombinant Full Length Human CDK6 Protein, C-Flag-tagged
Cat.No. : | CDK6-790HFL |
Product Overview : | Recombinant Full Length Human CDK6 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a member of the CMGC family of serine/threonine protein kinases. This kinase is a catalytic subunit of the protein kinase complex that is important for cell cycle G1 phase progression and G1/S transition. The activity of this kinase first appears in mid-G1 phase, which is controlled by the regulatory subunits including D-type cyclins and members of INK4 family of CDK inhibitors. This kinase, as well as CDK4, has been shown to phosphorylate, and thus regulate the activity of, tumor suppressor protein Rb. Altered expression of this gene has been observed in multiple human cancers. A mutation in this gene resulting in reduced cell proliferation, and impaired cell motility and polarity, and has been identified in patients with primary microcephaly. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 36.8 kDa |
AA Sequence : | MEKDGLCRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIREVAVLRHLET FEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTETIKDMMFQLLRGLDFLHSHR VVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVVVTLWYRAPEVLLQSSYATPVDLWSVGCIFA EMFRRKPLFRGSSDVDQLGKILDVIGLPGEEDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKC LTFNPAKRISAYSALSHPYFQDLERCKENLDSHLPPSQNTSELNTATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Protein Kinase |
Protein Pathways : | Cell cycle, Chronic myeloid leukemia, Glioma, Melanoma, Non-small cell lung cancer, p53 signaling pathway, Pancreatic cancer, Pathways in cancer, Small cell lung cancer |
Full Length : | Full L. |
Gene Name | CDK6 cyclin dependent kinase 6 [ Homo sapiens (human) ] |
Official Symbol | CDK6 |
Synonyms | MCPH12; PLSTIRE |
Gene ID | 1021 |
mRNA Refseq | NM_001259.8 |
Protein Refseq | NP_001250.1 |
MIM | 603368 |
UniProt ID | Q00534 |
◆ Recombinant Proteins | ||
CDK6-27908TH | Recombinant Human CDK6, His-tagged | +Inquiry |
CDK6/CCND1-277H | Recombinant Human CDK6/CCND1, His-tagged, GST-tagged, Active | +Inquiry |
CDK6-790HFL | Recombinant Full Length Human CDK6 Protein, C-Flag-tagged | +Inquiry |
CDK6-3129HF | Recombinant Full Length Human CDK6 Protein, GST-tagged | +Inquiry |
CDK6-27H | Recombinant Human CDK6/CCND2 Protein (Full length), N-GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDK6-7622HCL | Recombinant Human CDK6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CDK6 Products
Required fields are marked with *
My Review for All CDK6 Products
Required fields are marked with *
0
Inquiry Basket