Description :	CDK5 Regulatory Subunit-Associated Protein 3 (CDK5RAP3) is a member of the CDK5RAP3 family. CDK5RAP3 is widely expressed and it is phosphorylated by CDK5 in vitro. CDK5RAP3 regulates CDK5 activity via its interaction with CDK5R1. This interaction is prevented by the association between CDK5R1 and CDK5RAP3. CDK5RAP3 can also interact with enteric adenovirus serotype 41 fiber protein and UFL1. CDK5RAP3 may act as a potential regulator of CDK5 activity. In addition, CDK5RAP3 may be involved in cell proliferation.
Source :	HEK293
Species :	Human
Tag :	His
AA Sequence :	MEDHQHVPIDIQTSKLLDWLVDRRHCSLKWQSLVLTIREKINAAIQDMPESEEIAQLLSGSYIHY FHCLRILDLLKGTEASTKNIFGRYSSQRMKDWQEIIALYEKDNTYLVELSSLLVRNVNYEIPSLK KQIAKCQQLQQEYSRKEEECQAGAAEMREQFYHSCKQYGITGENVRGELLALVKDLPSQLAEIGA AAQQSLGEAIDVYQASVGFVCESPTEQVLPMLRFVQKRGNSTVYEWRTGTEPSVVERPHLEELPE QVAEDAIDWGDFGVEAVSEGTDSGISAEAAGIDWGIFPESDSKDPGGDGIDWGDDAVALQITVLE AGTQAPEGVARGPDALTLLEYTETRNQFLDELMELEIFLAQRAVELSEEADVLSVSQFQLAPAIL QGQTKEKMVTMVSVLEDLIGKLTSLQLQHLFMILASPRYVDRVTEFLQQKLKQSQLLALKKELMV QKQQEALEEQAALEPKLDLLLEKTKELQKLIEADISKRYSGRPVNLMGTSLVDHHHHHH
Endotoxin :	Less than 0.1 ng/μg (1 IEU/μg).
Purity :	Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.

Gene Name	CDK5RAP3 CDK5 regulatory subunit associated protein 3 [ Homo sapiens ]
Official Symbol	CDK5RAP3
Synonyms	CDK5RAP3; CDK5 regulatory subunit associated protein 3; CDK5 regulatory subunit-associated protein 3; C53; FLJ13660; HSF 27; IC53; ischemic heart CDK5 activator binding protein C53; LXXLL/leucine zipper containing ARFbinding protein; LZAP; MST016; OK/SW cl.114; ischemic heart CDK5 activator-binding protein C53; LXXLL/leucine-zipper-containing ARFbinding protein; HSF-27; OK/SW-cl.114;
Gene ID	80279
mRNA Refseq	NM_176096
Protein Refseq	NP_788276
MIM	608202
UniProt ID	Q96JB5
Chromosome Location	17q21.2
Function	neuronal Cdc2-like kinase binding; protein binding;

RRM2-705H	Recombinant Full Length Human Ribonucleotide Reductase M2, His-tagged	+Inquiry
FIS1-2477H	Recombinant Human FIS1, His-tagged	+Inquiry
RAB27A-2479H	Recombinant Human RAB27A, His-tagged	+Inquiry
RAB11A-2480H	Recombinant Human RAB11A, Member RAS Oncogene Family, His-tagged	+Inquiry
ADK-2481H	Recombinant Human Adenosine Kinase, His-tagged	+Inquiry

COA

Cat.No. :	CDK5RAP3-62H
Product Overview :	Recombinant Human CDK5 Regulatory Subunit-Associated Protein 3/CDK5RAP3 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Met1-Lys506) of Human CDK5RAP3 fused with a polyhistidine tag at the C-terminus.

Recombinant Human CDK5RAP3, His-tagged