Recombinant Human CDK4 protein, T7-tagged

• Cat.No.: CDK4-191H
• Product Overview: Recombinant human CDK4 (303 aa) protein fused with T7 Tag at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: T7
• ProteinLength: 303 a.a.
• Form: 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
• AA Sequence: MASMTGGQQMGRGEFMATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVREVALL RRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDLMRQFLRGLDFLHANC IVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRR KPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRIS AFRALQHSYLHKDEGNPE
• Purity: >90% by SDS-PAGE.
• Storage: Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days.

Gene Information

• Gene Name: CDK4 cyclin-dependent kinase 4 [ Homo sapiens ]
• Official Symbol: CDK4
• Synonyms: CDK4; cyclin-dependent kinase 4; PSK J3; cell division protein kinase 4; CMM3; PSK-J3; MGC14458
• Gene ID: 1019
• mRNA Refseq: NM_000075
• Protein Refseq: NP_000066
• MIM: 123829
• UniProt ID: P11802
• Chromosome Location: 12q13
• Pathway: ATF-2 transcription factor network, organism-specific biosystem; B Cell Receptor Signaling Pathway, organism-specific biosystem; Bladder cancer, organism-specific biosystem; Bladder cancer, conserved biosystem; Calcineurin-regulated NFAT-dependent transcription in lymphocytes, organism-specific biosystem; Cell Cycle, organism-specific biosystem; Cell Cycle, Mitotic, organism-specific biosystem
• Function: ATP binding; cyclin-dependent protein kinase activity; nucleotide binding; protein binding; protein kinase activity