Recombinant Human CDK4 protein, T7-tagged

Cat.No. : CDK4-191H
Product Overview : Recombinant human CDK4 (303 aa) protein fused with T7 Tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : T7
Protein Length : 303 a.a.
Form : 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence : MASMTGGQQMGRGEFMATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVREVALL RRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDLMRQFLRGLDFLHANC IVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRR KPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRIS AFRALQHSYLHKDEGNPE
Purity : >90% by SDS-PAGE.
Storage : Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days.
Gene Name CDK4 cyclin-dependent kinase 4 [ Homo sapiens ]
Official Symbol CDK4
Synonyms CDK4; cyclin-dependent kinase 4; PSK J3; cell division protein kinase 4; CMM3; PSK-J3; MGC14458;
Gene ID 1019
mRNA Refseq NM_000075
Protein Refseq NP_000066
MIM 123829
UniProt ID P11802
Chromosome Location 12q13
Pathway ATF-2 transcription factor network, organism-specific biosystem; B Cell Receptor Signaling Pathway, organism-specific biosystem; Bladder cancer, organism-specific biosystem; Bladder cancer, conserved biosystem; Calcineurin-regulated NFAT-dependent transcription in lymphocytes, organism-specific biosystem; Cell Cycle, organism-specific biosystem; Cell Cycle, Mitotic, organism-specific biosystem;
Function ATP binding; cyclin-dependent protein kinase activity; nucleotide binding; protein binding; protein kinase activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CDK4 Products

Required fields are marked with *

My Review for All CDK4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon