Recombinant Human CDK4 protein, His-tagged

• Cat.No.: CDK4-2208H
• Product Overview: Recombinant Human CDK4 protein(P11802)(2-303aa), fused to N-terminal His tag, was expressed in Insect Cell.

Specification

• Species: Human
• Source: Insect Cells
• Tag: His
• Protein Length: 2-303aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 35.6 kDa
• AA Sequence: ATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVREVALLRRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDLMRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Gene Information

• Gene Name: CDK4 cyclin-dependent kinase 4 [ Homo sapiens ]
• Official Symbol: CDK4
• Synonyms: CDK4; cyclin-dependent kinase 4; PSK J3; cell division protein kinase 4; CMM3; PSK-J3; MGC14458
• Gene ID: 1019
• mRNA Refseq: NM_000075
• Protein Refseq: NP_000066
• MIM: 123829
• UniProt ID: P11802