Recombinant Human CDK4 protein, His-tagged
Cat.No. : | CDK4-2208H |
Product Overview : | Recombinant Human CDK4 protein(P11802)(2-303aa), fused to N-terminal His tag, was expressed in Insect Cell. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Insect Cells |
Tag : | His |
Protein Length : | 2-303aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 35.6 kDa |
AA Sequence : | ATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVREVALLRRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDLMRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CDK4 cyclin-dependent kinase 4 [ Homo sapiens ] |
Official Symbol | CDK4 |
Synonyms | CDK4; cyclin-dependent kinase 4; PSK J3; cell division protein kinase 4; CMM3; PSK-J3; MGC14458; |
Gene ID | 1019 |
mRNA Refseq | NM_000075 |
Protein Refseq | NP_000066 |
MIM | 123829 |
UniProt ID | P11802 |
◆ Recombinant Proteins | ||
Cdk4-5846M | Recombinant Mouse Cdk4 protein, His-tagged | +Inquiry |
CDK4-758HAF647 | Recombinant Human CDK4 Protein, GST-tagged, Alexa Fluor 647 conjugated | +Inquiry |
CDK4-1304R | Recombinant Rat CDK4 Protein | +Inquiry |
CDK4-758HF | Recombinant Human CDK4 Protein, GST-tagged, FITC conjugated | +Inquiry |
CDK4-758HAF555 | Recombinant Human CDK4 Protein, GST-tagged, Alexa Fluor 555 conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDK4-664HCL | Recombinant Human CDK4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CDK4 Products
Required fields are marked with *
My Review for All CDK4 Products
Required fields are marked with *
0
Inquiry Basket