Recombinant Human CDK16, His-tagged

• Cat.No.: CDK16-29485TH
• Product Overview: Recombinant fragment, corresponding to amino acids 338-496 of Human PCTAIRE1 with N terminal His tag; 159 amino acids, 20kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 338-496 a.a.
• Description: The protein encoded by this gene belongs to the cdc2/cdkx subfamily of the ser/thr family of protein kinases. It may play a role in signal transduction cascades in terminally differentiated cells; in exocytosis; and in transport of secretory cargo from the endoplasmic reticulum. This gene is thought to escape X inactivation. Alternative splicing results in multiple transcript variants encoding different isoforms.
• Conjugation: HIS
• Form: Lyophilised:Reconstitute with 114 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: DYSTQIDMWGVGCIFYEMATGRPLFPGSTVEEQLHFIFRI LGTPTEETWPGILSNEEFKTYNYPKYRAEALLSHAPRL DSDGADLLTKLLQFEGRNRISAEDAMKHPFFLSLGERIHKLPDTTSIFALKEIQLQKEASLRSSSMPDSGRPAFRVVD TEF
• Sequence Similarities: Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily.Contains 1 protein kinase domain.

Gene Information

• Gene Name: CDK16 cyclin-dependent kinase 16 [ Homo sapiens ]
• Official Symbol: CDK16
• Synonyms: CDK16; cyclin-dependent kinase 16; PCTAIRE protein kinase 1 , PCTK1; FLJ16665; PCTAIRE; PCTAIRE1; PCTGAIRE; serine/threonine protein kinase
• Gene ID: 5127
• mRNA Refseq: NM_001170460
• Protein Refseq: NP_001163931
• MIM: 311550
• Uniprot ID: Q00536
• Chromosome Location: Xp11
• Function: ATP binding; cyclin-dependent protein kinase activity; nucleotide binding; protein binding; protein kinase activity