Recombinant Human CDK11B Protein, GST-tagged

• Cat.No.: CDK11B-5130H
• Product Overview: Human CDC2L1 partial ORF ( NP_001778, 686 a.a. - 795 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a member of the serine/threonine protein kinase family. Members of this kinase family are known to be essential for eukaryotic cell cycle control. Due to a segmental duplication, this gene shares very high sequence identity with a neighboring gene. These two genes are frequently deleted or altered in neuroblastoma. The protein kinase encoded by this gene can be cleaved by caspases and may play a role in cell apoptosis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2014]
• Molecular Mass: 37.84 kDa
• AA Sequence: KRFGALLSDQGFDLMNKFLTYFPGRRISAEDGLKHEYFRETPLPIDPSMFPTWPAKSEQQRVKRGTSPRPPEGGLGYSQLGDDDLKETGFHLTTTNQGASAAGPGFSLKF
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CDK11B cyclin dependent kinase 11B [ Homo sapiens (human) ]
• Official Symbol: CDK11B
• Synonyms: CDC2L1; CDK11B; cyclin dependent kinase 11B; p58; PK58; CDK11; CLK-1; CDC2L1; PITSLREA; p58CLK-1; CDK11-p46; CDK11-p58; p58CDC2L1; CDK11-p110; cyclin-dependent kinase 11B; CDC-related protein kinase p58; PITSLRE serine/threonine-protein kinase CDC2L1; cell division cycle 2-like 1 (PITSLRE proteins); cell division protein kinase 11B; galactosyltransferase-associated protein kinase p58/GTA; p58 CLK-1; EC 2.7.11.22
• Gene ID: 984
• mRNA Refseq: NM_001291345
• Protein Refseq: NP_001278274
• MIM: 176873
• UniProt ID: P21127