Recombinant Human CDH5 Protein, GST-Tagged

• Cat.No.: CDH5-0991H
• Product Overview: Human CDH5 partial ORF (NP_001786, 51 a.a. - 150 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a classical cadherin of the cadherin superfamily. The encoded preproprotein is proteolytically processed to generate the mature glycoprotein. This calcium-dependent cell-cell adhesion molecule is comprised of five extracellular cadherin repeats, a transmembrane region and a highly conserved cytoplasmic tail. Functioning as a classical cadherin by imparting to cells the ability to adhere in a homophilic manner, this protein plays a role in endothelial adherens junction assembly and maintenance. This gene is located in a gene cluster in a region on the long arm of chromosome 16 that is involved in loss of heterozygosity events in breast and prostate cancer. [provided by RefSeq, Nov 2015]
• Molecular Mass: 36.74 kDa
• AA Sequence: WNQMHIDEEKNTSLPHHVGKIKSSVSRKNAKYLLKGEYVGKVFRVDAETGDVFAIERLDRENISEYHLTAVIVDKDTGENLETPSSFTIKVHDVNDNWPV
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CDH5 cadherin 5, type 2 (vascular endothelium) [ Homo sapiens ]
• Official Symbol: CDH5
• Synonyms: CDH5; cadherin 5, type 2 (vascular endothelium); cadherin 5, type 2, VE cadherin (vascular epithelium); cadherin-5; 7B4; CD144; VE cadherin; 7B4 antigen; VE-cadherin; cd144 antigen; endothelial-specific cadherin; vascular endothelial cadherin; cadherin 5, type 2, VE-cadherin (vascular epithelium); FLJ17376
• Gene ID: 1003
• mRNA Refseq: NM_001795
• Protein Refseq: NP_001786
• MIM: 601120
• UniProt ID: P33151