Recombinant Human CDH13 protein, T7/His-tagged
Cat.No. : | CDH13-31H |
Product Overview : | Recombinant human CDH13 extracellular domain (139-693 aa) fused with 31 N-terminal T7/His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Protein Length : | 139-693 a.a. |
Form : | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGGEFELSIVVSPILIPENQRQPFPRDVGKVVDSDRPERSKFRLTGKGVDQ EPKGIFRINENTGSVSVTRTLDREVIAVYQLFVETTDVNGKTLEGPVPLEVIVIDQNDNRPIFREGPYIGHVMEG SPTGTTVMRMTAFDADDPATDNALLRYNIRQQTPDKPSPNMFYIDPEKGDIVTVVSPALLDRETLENPKYELIIE AQDMAGLDVGLTGTATATIMIDDKNDHSPKFTKKEFQATVEEGAVGVIVNLTVEDKDDPTTGAWRAAYTIINGNP GQSFEIHTNPQTNEGMLSVVKPLDYEISAFHTLLIKVENEDPLVPDVSYGPSSTATVHITVLDVNEGPVFYPDPM MVTRQEDLSVGSVLLTVNATDPDSLQHQTIRYSVYKDPAGWLNINPINGTVDTTAVLDRESPFVDNSVYTALFLA IDSGNPPATGTGTLLITLEDVNDNAPFIYPTVAEVCDDAKNLSVVILGASDKDLHPNTDPFKFEIHKQAVPDKVW KISKINNTHALVSLLQNLNKANYNLPIMVTDSGKPPMTNITDLRVQVCSCRNSKVDCNAAG |
Purity : | >90% by SDS-PAGE |
Applications : | 1. Protein can be used as coating matrix protein for study human neuronal and vascular endothelial cell / Recceptor interaction in vitro.2. As highly purified protein, may be used as culture matrix protein for human neuronal axon connection study in vitro. |
Storage : | Keep at -20centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days. |
Gene Name | CDH13 cadherin 13, H-cadherin (heart) [ Homo sapiens ] |
Official Symbol | CDH13 |
Synonyms | CDH13; cadherin 13, H-cadherin (heart); cadherin-13; CDHH; T cadherin; T-cad; H-cadherin; T-cadherin; heart cadherin; P105; |
Gene ID | 1012 |
mRNA Refseq | NM_001220488 |
Protein Refseq | NP_001207417 |
MIM | 601364 |
UniProt ID | P55290 |
Chromosome Location | 16q23.3 |
Pathway | Adherens junctions interactions, organism-specific biosystem; Cell junction organization, organism-specific biosystem; Cell-Cell communication, organism-specific biosystem; Cell-cell junction organization, organism-specific biosystem; |
Function | adiponectin binding; cadherin binding; calcium ion binding; lipoprotein particle binding; low-density lipoprotein particle binding; |
◆ Recombinant Proteins | ||
Cdh13-1948R | Recombinant Rat Cdh13 protein, His & GST-tagged | +Inquiry |
CDH13-3864H | Recombinant Human CDH13 Protein (Glu23-Ala692), C-His tagged | +Inquiry |
Cdh13-1505M | Recombinant Mouse Cdh13 Protein, His (Fc)-Avi-tagged | +Inquiry |
CDH13-31H | Recombinant Human CDH13 protein, T7/His-tagged | +Inquiry |
Cdh13-148R | Recombinant Rat Cdh13 Protein, hFc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDH13-802RCL | Recombinant Rat CDH13 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CDH13 Products
Required fields are marked with *
My Review for All CDH13 Products
Required fields are marked with *
0
Inquiry Basket