Recombinant Human CDH10, His-tagged

Cat.No. : CDH10-26741TH
Product Overview : Recombinant fragment, corresponding to amino acids 228-514 of Human cadherin 10 with N terminal His tag; MWt 33kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : This gene encodes a type II classical cadherin from the cadherin superfamily, integral membrane proteins that mediate calcium-dependent cell-cell adhesion. Mature cadherin proteins are composed of a large N-terminal extracellular domain, a single membrane-spanning domain, and a small, highly conserved C-terminal cytoplasmic domain. The extracellular domain consists of 5 subdomains, each containing a cadherin motif, and appears to determine the specificity of the proteins homophilic cell adhesion activity. Type II (atypical) cadherins are defined based on their lack of a HAV cell adhesion recognition sequence specific to type I cadherins. This particular cadherin is predominantly expressed in brain and is putatively involved in synaptic adhesions, axon outgrowth and guidance.
Conjugation : HIS
Source : E. coli
Form : Lyophilised:Reconstitute with 147 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : ENREQYQVVIQAKDMGGQMGGLSGTTTVNITLTDVNDNPP RFPQNTIHLRVLESSPVGTAIGSVKATDADTGKNAEVE YRIIDGDGTDMFDIVTEKDTQEGIITVKKPLDYESRRL YTLKVEAENTHVDPRFYYLGPFKDTTIVKISIEDVDEP PVFSRSSYLFEVHEDIEVGTIIGTVMARDPDSISSPIRFS LDRHTDLDRIFNIHSGNGSLYTSKPLDRELSQWHNLTV IAAEINNPKETTRVAVFVRILDVNDNAPQFAVFYDTFV CENARPGQLIQTISAVD
Protein length : 228-514 a.a.
Gene Name CDH10 cadherin 10, type 2 (T2-cadherin) [ Homo sapiens ]
Official Symbol CDH10
Synonyms CDH10; cadherin 10, type 2 (T2-cadherin); cadherin-10;
Gene ID 1008
mRNA Refseq NM_006727
Protein Refseq NP_006718
MIM 604555
Uniprot ID Q9Y6N8
Chromosome Location 5p14.2
Pathway Adherens junctions interactions, organism-specific biosystem; Cell junction organization, organism-specific biosystem; Cell-Cell communication, organism-specific biosystem; Cell-cell junction organization, organism-specific biosystem;
Function calcium ion binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CDH10 Products

Required fields are marked with *

My Review for All CDH10 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon