Recombinant Human CDH1 protein(791-880 aa), C-His-tagged

• Cat.No.: CDH1-2645H
• Product Overview: Recombinant Human CDH1 protein(P12830)(791-880 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• ProteinLength: 791-880 aa
• Form: 0.15 M Phosphate buffered saline
• AASequence: LMSVPRYLPRPANPDEIGNFIDENLKAADTDPTAPPYDSLLVFDYEGSGSEAASLSSLNSSESDKDQDYDYLNEWGNRFKKLADMYGGGE
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: CDH1 cadherin 1, type 1, E-cadherin (epithelial) [ Homo sapiens ]
• Official Symbol: CDH1
• Synonyms: CDH1; cadherin 1, type 1, E-cadherin (epithelial); UVO; cadherin-1; CD324; E Cadherin; uvomorulin; CAM 120/80; E-Cadherin; cell-CAM 120/80; epithelial cadherin; cadherin 1, E-cadherin (epithelial); calcium-dependent adhesion protein, epithelial; CDHE; ECAD; LCAM; Arc-1
• Gene ID: 999
• mRNA Refseq: NM_004360
• Protein Refseq: NP_004351
• MIM: 192090
• UniProt ID: P12830