Recombinant Human CDCA4 Protein, GST-Tagged

• Cat.No.: CDCA4-0961H
• Product Overview: Human CDCA4 full-length ORF (NP_663747.1, 1 a.a. - 241 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a protein that belongs to the E2F family of transcription factors. This protein regulates E2F-dependent transcriptional activation and cell proliferation, mainly through the E2F/retinoblastoma protein pathway. It also functions in the regulation of JUN oncogene expression. This protein shows distinctive nuclear-mitotic apparatus distribution, it is involved in spindle organization from prometaphase, and may also play a role as a midzone factor involved in chromosome segregation or cytokinesis. Two alternatively spliced transcript variants encoding the same protein have been noted for this gene. Two pseudogenes have also been identified on chromosome 1. [provided by RefSeq, May 2014]
• Molecular Mass: 52.5 kDa
• AA Sequence: MFARGLKRKCVGHEEDVEGALAGLKTVSSYSLQRQSLLDMSLVKLQLCHMLVEPNLCRSVLIANTVRQIQEEMTQDGTWRTVAPQAAERAPLDRLVSTEILCRAAWGQEGAHPAPGLGDGHTQGPVSDLCPVTSAQAPRHLQSSAWEMDGPRENRGSFHKSLDQIFETLETKNPSCMEELFSDVDSPYYDLDTVLTGMMGGARPGPCEGLEGLAPATPGPSSSCKSDLGELDHVVEILVET
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CDCA4 cell division cycle associated 4 [ Homo sapiens ]
• Official Symbol: CDCA4
• Synonyms: CDCA4; cell division cycle associated 4; cell division cycle-associated protein 4; FLJ20764; hematopoietic progenitor protein; Hepp; HEPP; SEI-3/HEPP; FLJ52878; MGC19517
• Gene ID: 55038
• mRNA Refseq: NM_017955
• Protein Refseq: NP_060425
• MIM: 612270
• UniProt ID: Q9BXL8