Recombinant Human CDC7 Protein, GST-Tagged

• Cat.No.: CDC7-0957H
• Product Overview: Human CDC7 partial ORF (NP_003494, 201 a.a. - 300 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a cell division cycle protein with kinase activity that is critical for the G1/S transition. The yeast homolog is also essential for initiation of DNA replication as cell division occurs. Overexpression of this gene product may be associated with neoplastic transformation for some tumors. Multiple alternatively spliced transcript variants that encode the same protein have been detected. [provided by RefSeq, Aug 2008]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 36.63 kDa
• AA Sequence: QGTHDTKIELLKFVQSEAQQERCSQNKSHIITGNKIPLSGPVPKELDQQSTTKASVKRPYTNAQIQIKQGKDGKEGSVGLSVQRSVFGERNFNIHSSISH
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CDC7 cell division cycle 7 homolog (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: CDC7
• Synonyms: CDC7; cell division cycle 7 homolog (S. cerevisiae); CDC7 (cell division cycle 7, S. cerevisiae, homolog) like 1, CDC7 cell division cycle 7 (S. cerevisiae), CDC7L1, cell division cycle 7 (S. cerevisiae); cell division cycle 7-related protein kinase; HsCdc7; Hsk1; huCdc7; CDC7-related kinase; cell division cycle 7-like protein 1; CDC7 (cell division cycle 7, S. cerevisiae, homolog)-like 1; CDC7L1; HsCDC7; huCDC7; MGC117361; MGC126237; MGC126238
• Gene ID: 8317
• mRNA Refseq: NM_001134419
• Protein Refseq: NP_001127891
• MIM: 603311
• UniProt ID: O00311