Recombinant Human CDC7 Protein, GST-Tagged
Cat.No. : | CDC7-0957H |
Product Overview : | Human CDC7 partial ORF (NP_003494, 201 a.a. - 300 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a cell division cycle protein with kinase activity that is critical for the G1/S transition. The yeast homolog is also essential for initiation of DNA replication as cell division occurs. Overexpression of this gene product may be associated with neoplastic transformation for some tumors. Multiple alternatively spliced transcript variants that encode the same protein have been detected. [provided by RefSeq, Aug 2008] |
Molecular Mass : | 36.63 kDa |
AA Sequence : | QGTHDTKIELLKFVQSEAQQERCSQNKSHIITGNKIPLSGPVPKELDQQSTTKASVKRPYTNAQIQIKQGKDGKEGSVGLSVQRSVFGERNFNIHSSISH |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CDC7 cell division cycle 7 homolog (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | CDC7 |
Synonyms | CDC7; cell division cycle 7 homolog (S. cerevisiae); CDC7 (cell division cycle 7, S. cerevisiae, homolog) like 1, CDC7 cell division cycle 7 (S. cerevisiae), CDC7L1, cell division cycle 7 (S. cerevisiae); cell division cycle 7-related protein kinase; HsCdc7; Hsk1; huCdc7; CDC7-related kinase; cell division cycle 7-like protein 1; CDC7 (cell division cycle 7, S. cerevisiae, homolog)-like 1; CDC7L1; HsCDC7; huCDC7; MGC117361; MGC126237; MGC126238; |
Gene ID | 8317 |
mRNA Refseq | NM_001134419 |
Protein Refseq | NP_001127891 |
MIM | 603311 |
UniProt ID | O00311 |
◆ Recombinant Proteins | ||
CDC7-021H | Recombinant Human CDC7 Protein, His-tagged | +Inquiry |
CDC7-1793Z | Recombinant Zebrafish CDC7 | +Inquiry |
CDC7-0958H | Active Recombinant Human CDC7 Protein, GST-Tagged | +Inquiry |
CDC7-596R | Recombinant Rhesus Macaque CDC7 Protein, His (Fc)-Avi-tagged | +Inquiry |
CDC7-997H | Recombinant Human Cell Division Cycle 7 Homolog (S. cerevisiae), GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CDC7-7646HCL | Recombinant Human CDC7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CDC7 Products
Required fields are marked with *
My Review for All CDC7 Products
Required fields are marked with *
0
Inquiry Basket