Recombinant Human CDC42EP2 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: CDC42EP2-1650H
• Product Overview: CDC42EP2 MS Standard C13 and N15-labeled recombinant protein (NP_006770) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: CDC42, a small Rho GTPase, regulates the formation of F-actin-containing structures through its interaction with the downstream effector proteins. The protein encoded by this gene is a member of the Borg family of CDC42 effector proteins. Borg family proteins contain a CRIB (Cdc42/Rac interactive-binding) domain. They bind to, and negatively regulate the function of CDC42. Coexpression of this protein with CDC42 suggested a role of this protein in actin filament assembly and cell shape control.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 22.5 kDa
• AA Sequence: MSTKVPIYLKRGSRKGKKEKLRDLLSSDMISPPLGDFRHTIHIGSGGGSDMFGDISFLQGKFHLLPGTMVEGPEEDGTFDLPFQFTRTATVCGRELPDGPSPLLKNAISLPVIGGPQALTLPTAQAPPKPPRLHLETPQPSPQEGGSVDIWRIPETGSPNSGLTPESGAEEPFLSNASSLLSLHVDLGPSILDDVLQIMDQDLDSMQIPTTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: CDC42EP2 CDC42 effector protein 2 [ Homo sapiens (human) ]
• Official Symbol: CDC42EP2
• Synonyms: CDC42EP2; CDC42 effector protein (Rho GTPase binding) 2; cdc42 effector protein 2; BORG1; CEP2; CRIB containing BOGR1 protein; binder of Rho GTPases 1; CRIB-containing BOGR1 protein
• Gene ID: 10435
• mRNA Refseq: NM_006779
• Protein Refseq: NP_006770
• MIM: 606132
• UniProt ID: O14613