Recombinant Human CDC26 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: CDC26-4328H
• Product Overview: CDC26 MS Standard C13 and N15-labeled recombinant protein (NP_644815) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: The protein encoded by this gene is highly similar to Saccharomyces cerevisiae Cdc26, a component of cell cycle anaphase-promoting complex (APC). APC is composed of a group of highly conserved proteins and functions as a cell cycle-regulated ubiquitin-protein ligase. APC thus is responsible for the cell cycle regulated proteolysis of various proteins.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 9.8 kDa
• AA Sequence: MLRRKPTRLELKLDDIEEFENIRKDLETRKKQKEDVEVVGGSDGEGAIGLSSDPKSREQMINDRIGYKPQPKPNNRSSQFGSLEFTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: CDC26 cell division cycle 26 [ Homo sapiens (human) ]
• Official Symbol: CDC26
• Synonyms: CDC26; cell division cycle 26 homolog (S. cerevisiae); C9orf17, cell division cycle 26, chromosome 9 open reading frame 17; anaphase-promoting complex subunit CDC26; ANAPC12; anaphase promoting complex subunit 12; APC12; CDC26 subunit of anaphase promoting complex; anaphase-promoting complex subunit 12; cell division cycle protein 26 homolog; C9orf17
• Gene ID: 246184
• mRNA Refseq: NM_139286
• Protein Refseq: NP_644815
• MIM: 614533
• UniProt ID: Q8NHZ8