Recombinant Human CDC20 protein, His&Myc-tagged

• Cat.No.: CDC20-5841H
• Product Overview: Recombinant Human CDC20 protein(Q12834)(1-499aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&Myc
• ProteinLength: 1-499aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 62.2 kDa
• AA Sequence: MAQFAFESDLHSLLQLDAPIPNAPPARWQRKAKEAAGPAPSPMRAANRSHSAGRTPGRTPGKSSSKVQTTPSKPGGDRYIPHRSAAQMEVASFLLSKENQPENSQTPTKKEHQKAWALNLNGFDVEEAKILRLSGKPQNAPEGYQNRLKVLYSQKATPGSSRKTCRYIPSLPDRILDAPEIRNDYYLNLVDWSSGNVLAVALDNSVYLWSASSGDILQLLQMEQPGEYISSVAWIKEGNYLAVGTSSAEVQLWDVQQQKRLRNMTSHSARVGSLSWNSYILSSGSRSGHIHHHDVRVAEHHVATLSGHSQEVCGLRWAPDGRHLASGGNDNLVNVWPSAPGEGGWVPLQTFTQHQGAVKAVAWCPWQSNVLATGGGTSDRHIRIWNVCSGACLSAVDAHSQVCSILWSPHYKELISGHGFAQNQLVIWKYPTMAKVAELKGHTSRVLSLTMSPDGATVASAAADETLRLWRCFELDPARRREREKASAAKSSLIHQGIR
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: CDC20 cell division cycle 20 homolog (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: CDC20
• Synonyms: CDC20; cell division cycle 20 homolog (S. cerevisiae); CDC20 (cell division cycle 20, S. cerevisiae, homolog) , CDC20 cell division cycle 20 homolog (S. cerevisiae); cell division cycle protein 20 homolog; CDC20A; p55CDC; CDC20 cell division cycle 20 homolog; bA276H19.3; MGC102824
• Gene ID: 991
• mRNA Refseq: NM_001255
• Protein Refseq: NP_001246
• MIM: 603618
• UniProt ID: Q12834