Recombinant Human CDC20

• Cat.No.: CDC20-27897TH
• Product Overview: Recombinant fragment corresponding to amino acids 1-100 of Human Cdc20 with an N terminal proprietary tag; Predicted MWt 36.63 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• ProteinLength: 100 amino acids
• Description: CDC20 appears to act as a regulatory protein interacting with several other proteins at multiple points in the cell cycle.It is required for two microtubule-dependent processes, nuclear movement prior to anaphase and chromosome separation.
• Molecular Weight: 36.630kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MAQFAFESDLHSLLQLDAPIPNAPPARWQRKAKEAAGPAPSPMRAANRSHSAGRTPGRTPGKSSSKVQTTPSKPGGDRYIPHRSAAQMEVASFLLSKENQ
• Sequence Similarities: Belongs to the WD repeat CDC20/Fizzy family.Contains 7 WD repeats.

Gene Information

• Gene Name: CDC20 cell division cycle 20 homolog (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: CDC20
• Synonyms: CDC20; cell division cycle 20 homolog (S. cerevisiae); CDC20 (cell division cycle 20, S. cerevisiae, homolog) , CDC20 cell division cycle 20 homolog (S. cerevisiae); cell division cycle protein 20 homolog; CDC20A; p55CDC
• Gene ID: 991
• mRNA Refseq: NM_001255
• Protein Refseq: NP_001246
• MIM: 603618
• Uniprot ID: Q12834
• Chromosome Location: 1p34.1
• Pathway: APC/C complex, organism-specific biosystem; APC/C complex, conserved biosystem; APC/C-mediated degradation of cell cycle proteins, organism-specific biosystem; APC/C:Cdc20 mediated degradation of Cyclin B, organism-specific biosystem; APC/C:Cdc20 mediated degradation of Securin, organism-specific biosystem
• Function: enzyme binding; protein C-terminus binding; protein binding