Recombinant Full Length Human CDC20 Protein, GST-tagged

• Cat.No.: CDC20-3132HF
• Product Overview: Human CDC20 full-length ORF (AAH00624.1, 1 a.a. - 499 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 499 amino acids
• Description: CDC20 appears to act as a regulatory protein interacting with several other proteins at multiple points in the cell cycle. It is required for two microtubule-dependent processes, nuclear movement prior to anaphase and chromosome separation. [provided by RefSeq, Jul 2008]
• Molecular Mass: 81.2 kDa
• AA Sequence: MAQFAFESDLHSLLQLDAPIPNAPPARWQRKAKEAAGPAPSPMRAANRSHSAGRTPGRTPGKSSSKVQTTPSKPGGDRYIPHRSAAQMEVASFLLSKENQPENSQTPTKKEHQKAWVLNLNGFDVEEAKILRLSGKPQNAPEGYQNRLKVLYSQKATPGSSRKTCRYIPSLPDRILDAPEIRNDYYLNLVDWSSGNVLAVALDNSVYLWSASSGDILQLLQMEQPGEYISSVAWIKEGNYLAVGTSSAEVQLWDVQQQKRLRNMTSHSARVGSLSWNSYILSSGSRSGHIHHHDVRVAEHHVATLSGHSQEVCGLRWAPDGRHLASGGNDNLVNVWPSAPGEGGWVPLQTFTQHQGAVKAVAWCPWQSNVLATGGGTSDRHIRIWNVCSGACLSAVDAHSQVCSILWSPHYKELISGHGFAQNQLVIWKYPTMAKVAELKGHTSRVLSLTMSPDGATVASAAADETLRLWRCFELDPARRREREKASAAKSSLIHQGIR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CDC20 cell division cycle 20 homolog (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: CDC20
• Synonyms: CDC20; cell division cycle 20 homolog (S. cerevisiae); CDC20 (cell division cycle 20, S. cerevisiae, homolog), CDC20 cell division cycle 20 homolog (S. cerevisiae); cell division cycle protein 20 homolog; CDC20A; p55CDC; CDC20 cell division cycle 20 homolog; bA276H19.3; MGC102824
• Gene ID: 991
• mRNA Refseq: NM_001255
• Protein Refseq: NP_001246
• MIM: 603618
• UniProt ID: Q12834