Recombinant Human CD8a Protein, His-tagged

• Cat.No.: CD8A-1158H
• Product Overview: Recombinant Human CD8a Protein (22-182aa) was expressed in Yeast with N-terminal 6xHis-tag.

Specification

• Species: Human
• Source: Yeast
• Tag: His
• Protein Length: 22-182 a.a.
• Form: Tris-based buffer, 50% glycerol.
• Molecular Mass: 19.6 kDa
• AA Sequence: SQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSG
  KRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRP
  EACRPAAGGAVHTRGLDFACD
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.

Gene Information

• Gene Name: CD8A CD8a molecule [ Homo sapiens ]
• Official Symbol: CD8A
• Synonyms: CD8A; CD8a molecule; CD8, CD8 antigen, alpha polypeptide (p32) , T cell surface glycoprotein CD8 alpha chain; T-cell surface glycoprotein CD8 alpha chain; T8 T-cell antigen; T cell co-receptor; OKT8 T-cell antigen; T-cell antigen Leu2; Leu2 T-lymphocyte antigen; CD8 antigen, alpha polypeptide (p32); T-lymphocyte differentiation antigen T8/Leu-2; CD8; MAL; p32; Leu2
• Gene ID: 925
• mRNA Refseq: NM_001145873
• Protein Refseq: NP_001139345
• MIM: 186910
• UniProt ID: P01732