Recombinant Human CD8A protein, His-SUMO-tagged

• Cat.No.: CD8A-2675H
• Product Overview: Recombinant Human CD8A protein(P01732)(22-182), fused to N-terminal His tag and SUMO tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 22-182
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 33.6 kDa
• AA Sequence: SQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: CD8A CD8a molecule [ Homo sapiens ]
• Official Symbol: CD8A
• Synonyms: CD8A; CD8a molecule; CD8, CD8 antigen, alpha polypeptide (p32) , T cell surface glycoprotein CD8 alpha chain; T-cell surface glycoprotein CD8 alpha chain; T8 T-cell antigen; T cell co-receptor; OKT8 T-cell antigen; T-cell antigen Leu2; Leu2 T-lymphocyte antigen; CD8 antigen, alpha polypeptide (p32); T-lymphocyte differentiation antigen T8/Leu-2; CD8; MAL; p32; Leu2
• Gene ID: 925
• mRNA Refseq: NM_001145873
• Protein Refseq: NP_001139345
• MIM: 186910
• UniProt ID: P01732